missing translation for 'onlineSavingsMsg'
Få mere at vide
  1. Home
  2. Products
  3. Antistoffer
  4. Primære antistoffer
  5. Alle primære antistoffer
  6. 30499071

CBFA2T3 Antibody [Allophycocyanin], Novus Biologicals Biologicals™

Artikelnummer. 30499071 Shop alle Bio Techne produkter
Skift visning
Klik for at se tilgængelige muligheder
Mængde:
0.1 mL
1 product options available for selection
Product selection table with 1 available options. Use arrow keys to navigate and Enter or Space to select.
Artikelnummer. Mængde
30499071 0.1 mL
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 1 options available.
1 options
Denne vare kan ikke returneres. Se returpolicy
Artikelnummer. 30499071 Leverandør Novus Biologicals Leverandørnr. NBP335460APC

Venligst for at købe denne vare. Brug for en webkonto? Register dig hos os i dag!

Denne vare kan ikke returneres. Se returpolicy

Beskrivelse

Rabbit Polyclonal Antibody

CBFA2T3 Polyclonal antibody specifically detects CBFA2T3 in Human,Mouse,Rat samples. It is validated for ELISA,Western Blot
TRUSTED_SUSTAINABILITY

Tekniske data

Antigen CBFA2T3
Applikationer ELISA, Western Blot
Klassifikation Polyclonal
Konjugeret APC
Formulering PBS
Gene Alias core-binding factor, runt domain, alpha subunit 2; translocated to, 3, hMTG16, MTG16ETO2, MTG8-related protein 2, MTGR2MTG8-related gene 2, Myeloid translocation gene on chromosome 16 protein, protein CBFA2T3, Zinc finger MYND domain-containing protein 4, ZMYND4myeloid translocation gene 8 and 16b
Værtsarter Rabbit
Immunogen Recombinant fusion protein containing a sequence corresponding to amino acids 593-653 of human CBFA2T3 (NP_005178.4).,, Sequence:, DRDPLHPEHLSKRPCTLNPAQRYSPSNGPPQPTPPPHYRLEDIAMAHHFRDAYRHPDPRELRERHRPLVVPGSRQEEVIDHKLTER
Oprensningsmetode Affinity purified
Mængde 0.1 mL
Regulatorisk status RUO
Primær eller sekundær Primary
Gen-id (Entrez) 863
Målarter Human, Mouse, Rat
Indhold og opbevaring Store at 4°C in the dark.
Produkttype Antibody
Form Purified
Isotype IgG
Vis mere Vis mindre
Produkttitel
Vælg et problem

Ved at klikke på Send, anerkender du, at du kan blive kontaktet af Fisher Scientific med hensyn til den feedback, du har givet i denne formular. Vi deler ikke dine oplysninger til andre formål. Alle angivne kontaktoplysninger skal også vedligeholdes i overensstemmelse med vores Privatlivspolitik.