missing translation for 'onlineSavingsMsg'
Få mere at vide
  1. Home
  2. Products
  3. Antistoffer
  4. Primære antistoffer
  5. Alle primære antistoffer
  6. 30498995

SMARCD2 Antibody [DyLight 650], Novus Biologicals Biologicals™

Artikelnummer. 30498995 Shop alle Bio Techne produkter
Skift visning
Klik for at se tilgængelige muligheder
Mængde:
0.1 mL
1 product options available for selection
Product selection table with 1 available options. Use arrow keys to navigate and Enter or Space to select.
Artikelnummer. Mængde
30498995 0.1 mL
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 1 options available.
1 options
Denne vare kan ikke returneres. Se returpolicy
Artikelnummer. 30498995 Leverandør Novus Biologicals Leverandørnr. NBP335216C

Venligst for at købe denne vare. Brug for en webkonto? Register dig hos os i dag!

Denne vare kan ikke returneres. Se returpolicy

Beskrivelse

Rabbit Polyclonal Antibody

SMARCD2 Polyclonal antibody specifically detects SMARCD2 in Human,Mouse,Rat samples. It is validated for ELISA,Immunohistochemistry,Western Blot,Immunohistochemistry (Paraffin)
TRUSTED_SUSTAINABILITY

Tekniske data

Antigen SMARCD2
Applikationer ELISA, Immunohistochemistry, Western Blot, Immunohistochemistry (Paraffin)
Klassifikation Polyclonal
Konjugeret DyLight 650
Formulering 50mM Sodium Borate
Gene Alias 60 kDa BRG-1/Brm-associated factor subunit B, BAF60B, BRG1-associated factor 60B, chromatin remodeling complex BAF60B subunit, CRACD2, mammalian chromatin remodeling complex BRG1-associated factor 60B, PRO2451, Rsc6p, SWI/SNF complex 60 kDa subunit B, SWI/SNF related, matrix associated, actin dependent regulator of chromatin, subfamily d, member 2, SWI/SNF-related matrix-associated actin-dependent regulator of chromatin subfamily D member 2, Swp73-like protein
Værtsarter Rabbit
Immunogen Recombinant fusion protein containing a sequence corresponding to amino acids 454-531 of human SMARCD2 (NP_001091896.1).,, Sequence:, RDFMLSFSTDPQDFIQEWLRSQRRDLKIITDVIGNPEEERRAAFYHQPWAQEAVGRHIFAKVQQRRQELEQVLGIRLT
Oprensningsmetode Affinity purified
Mængde 0.1 mL
Regulatorisk status RUO
Forskningsdisciplin Chromatin Research
Primær eller sekundær Primary
Gen-id (Entrez) 6603
Målarter Human, Mouse, Rat
Indhold og opbevaring Store at 4°C in the dark.
Produkttype Antibody
Form Purified
Isotype IgG
Vis mere Vis mindre
Produkttitel
Vælg et problem

Ved at klikke på Send, anerkender du, at du kan blive kontaktet af Fisher Scientific med hensyn til den feedback, du har givet i denne formular. Vi deler ikke dine oplysninger til andre formål. Alle angivne kontaktoplysninger skal også vedligeholdes i overensstemmelse med vores Privatlivspolitik.