missing translation for 'onlineSavingsMsg'
Få mere at vide
Få mere at vide
Fibrinopeptide B Antibody [Alexa Fluor« 405], Novus Biologicals Biologicals™
Shop alle Bio Techne produkterBeskrivelse
Fibrinopeptide B Polyclonal antibody specifically detects Fibrinopeptide B in Human,Mouse,Rat samples. It is validated for ELISA,Western Blot,Immunocytochemistry/ Immunofluorescence
Tekniske data
Tekniske data
| Antigen | Fibrinopeptide B |
| Applikationer | ELISA, Western Blot, Immunocytochemistry/Immunofluorescence |
| Klassifikation | Polyclonal |
| Konjugeret | Alexa Fluor 405 |
| Formulering | 50mM Sodium Borate |
| Gene Alias | fibrinogen beta chain, fibrinogen, B beta polypeptide, MGC104327, MGC120405 |
| Værtsarter | Rabbit |
| Immunogen | Recombinant fusion protein containing a sequence corresponding to amino acids 111-222 of human Fibrinopeptide B (NP_005132.2).,, Sequence:, QLQEALLQQERPIRNSVDELNNNVEAVSQTSSSSFQYMYLLKDLWQKRQKQVKDNENVVNEYSSELEKHQLYIDETVNSNIPTNLRVLRSILENLRSKIQKLESDVSAQMEY |
| Oprensningsmetode | Affinity purified |
| Mængde | 0.1 mL |
| Vis mere |
Produkttitel
Ved at klikke på Send, anerkender du, at du kan blive kontaktet af Fisher Scientific med hensyn til den feedback, du har givet i denne formular. Vi deler ikke dine oplysninger til andre formål. Alle angivne kontaktoplysninger skal også vedligeholdes i overensstemmelse med vores Privatlivspolitik.
Ser du en mulighed for forbedring?