missing translation for 'onlineSavingsMsg'
Få mere at vide
Få mere at vide
Gasdermin-C Antibody [Alexa Fluor« 488], Novus Biologicals Biologicals™
Shop alle Bio Techne produkterBeskrivelse
Gasdermin-C Polyclonal antibody specifically detects Gasdermin-C in Human,Mouse samples. It is validated for ELISA,Western Blot,Immunocytochemistry/ Immunofluorescence
Tekniske data
Tekniske data
| Antigen | Gasdermin-C |
| Applikationer | ELISA, Western Blot, Immunocytochemistry/Immunofluorescence |
| Klassifikation | Polyclonal |
| Konjugeret | Alexa Fluor 488 |
| Formulering | 50mM Sodium Borate |
| Gene Alias | gasdermin C, gasdermin-C, Melanoma-derived leucine zipper-containing extranuclear factor, MLZEmelanoma-derived leucine zipper, extra-nuclear factor |
| Værtsarter | Rabbit |
| Immunogen | Recombinant fusion protein containing a sequence corresponding to amino acids 1-100 of human Gasdermin-C (NP_113603.1).,, Sequence:, MPSMLERISKNLVKEIGSKDLTPVKYLLSATKLRQFVILRKKKDSRSSFWEQSDYVPVEFSLNDILEPSSSVLETVVTGPFHFSDIMIQKHKADMGVNVG |
| Oprensningsmetode | Affinity purified |
| Mængde | 0.1 mL |
| Vis mere |
Produkttitel
Ved at klikke på Send, anerkender du, at du kan blive kontaktet af Fisher Scientific med hensyn til den feedback, du har givet i denne formular. Vi deler ikke dine oplysninger til andre formål. Alle angivne kontaktoplysninger skal også vedligeholdes i overensstemmelse med vores Privatlivspolitik.
Ser du en mulighed for forbedring?