missing translation for 'onlineSavingsMsg'
Få mere at vide
  1. Home
  2. Products
  3. Antistoffer
  4. Primære antistoffer
  5. Alle primære antistoffer
  6. 30498902

PCAF Antibody [mFluor Violet 610 SE], Novus Biologicals Biologicals™

Artikelnummer. 30498902 Shop alle Bio Techne produkter
Skift visning
Klik for at se tilgængelige muligheder
Mængde:
0.1 mL
Pakningsstørrelse:
0.1ml
1 product options available for selection
Product selection table with 1 available options. Use arrow keys to navigate and Enter or Space to select.
Artikelnummer. Mængde unitSize
30498902 0.1 mL 0.1ml
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 1 options available.
1 options
Denne vare kan ikke returneres. Se returpolicy
Artikelnummer. 30498902 Leverandør Novus Biologicals Leverandørnr. NBP335063MFV610

Venligst for at købe denne vare. Brug for en webkonto? Register dig hos os i dag!

Denne vare kan ikke returneres. Se returpolicy

Beskrivelse

Rabbit Polyclonal Antibody

PCAF Polyclonal antibody specifically detects PCAF in Human,Mouse,Rat samples. It is validated for ELISA,Western Blot,Immunocytochemistry/ Immunofluorescence
TRUSTED_SUSTAINABILITY

Tekniske data

Antigen PCAF
Applikationer ELISA, Western Blot, Immunocytochemistry/Immunofluorescence
Klassifikation Polyclonal
Konjugeret mFluor Violet 610 SE
Formulering 50mM Sodium Borate
Gene Alias CREBBP-associated factor, EC 2.3.1.48, GCN5L, Histone acetylase PCAF, histone acetyltransferase KAT2B, Histone acetyltransferase PCAF, K(lysine) acetyltransferase 2B, Lysine acetyltransferase 2B, P, P/CAFGCN5, P300/CBP-associated factorCAF, PCAF
Værtsarter Rabbit
Immunogen Recombinant fusion protein containing a sequence corresponding to amino acids 1-86 of human PCAF (NP_003875.3).,, Sequence:, MSEAGGAGPGGCGAGAGAGAGPGALPPQPAALPPAPPQGSPCAAAAGGSGACGPATAVAAAGTAEGPGGGGSARIAVKKAQLRSAP
Oprensningsmetode Affinity purified
Mængde 0.1 mL
Regulatorisk status RUO
Forskningsdisciplin Cancer, Cell Cycle and Replication, Cellular Markers, Chromatin Research, HIF Target Genes, Hypoxia, Membrane Trafficking and Chaperones, Signal Transduction, Transcription Factors and Regulators
Primær eller sekundær Primary
Gen-id (Entrez) 8850
Målarter Human, Mouse, Rat
Indhold og opbevaring Store at 4°C in the dark.
Produkttype Antibody
Form Purified
Isotype IgG
Vis mere Vis mindre
Produkttitel
Vælg et problem

Ved at klikke på Send, anerkender du, at du kan blive kontaktet af Fisher Scientific med hensyn til den feedback, du har givet i denne formular. Vi deler ikke dine oplysninger til andre formål. Alle angivne kontaktoplysninger skal også vedligeholdes i overensstemmelse med vores Privatlivspolitik.