missing translation for 'onlineSavingsMsg'
Få mere at vide
  1. Home
  2. Products
  3. Antistoffer
  4. Primære antistoffer
  5. Alle primære antistoffer
  6. 30498870

Xanthine Oxidase Antibody [Janelia Fluor« 669], Novus Biologicals Biologicals™

Artikelnummer. 30498870 Shop alle Bio Techne produkter
Skift visning
Klik for at se tilgængelige muligheder
Mængde:
0.1 mL
1 product options available for selection
Product selection table with 1 available options. Use arrow keys to navigate and Enter or Space to select.
Artikelnummer. Mængde
30498870 0.1 mL
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 1 options available.
1 options
Denne vare kan ikke returneres. Se returpolicy
Artikelnummer. 30498870 Leverandør Novus Biologicals Leverandørnr. NBP335302JF669

Venligst for at købe denne vare. Brug for en webkonto? Register dig hos os i dag!

Denne vare kan ikke returneres. Se returpolicy

Beskrivelse

Rabbit Polyclonal Antibody

Xanthine Oxidase Polyclonal antibody specifically detects Xanthine Oxidase in Human,Mouse,Rat samples. It is validated for ELISA,Western Blot
TRUSTED_SUSTAINABILITY

Tekniske data

Antigen Xanthine Oxidase
Applikationer ELISA, Western Blot
Klassifikation Polyclonal
Konjugeret Janelia Fluor 669
Formulering 50mM Sodium Borate
Gene Alias EC 1.17.1.4, EC 1.7.2.2, xanthene dehydrogenase, xanthine dehydrogenase, xanthine dehydrogenase/oxidase, xanthine oxidase, xanthine oxidoreductase, XDHA, XO, XOR
Værtsarter Rabbit
Immunogen A synthetic peptide corresponding to a sequence within amino acids 985-1084 of human Xanthine Oxidase (XDH) (NP_000370.2).,, Sequence:, CIIPTKFGISFTVPFLNQAGALLHVYTDGSVLLTHGGTEMGQGLHTKMVQVASRALKIPTSKIYISETSTNTVPNTSPTAASVSADLNGQAVYAACQTILK
Oprensningsmetode Affinity purified
Mængde 0.1 mL
Regulatorisk status RUO
Forskningsdisciplin Signal Transduction
Primær eller sekundær Primary
Gen-id (Entrez) 7498
Målarter Human, Mouse, Rat
Indhold og opbevaring Store at 4°C in the dark.
Produkttype Antibody
Form Purified
Isotype IgG
Vis mere Vis mindre
Produkttitel
Vælg et problem

Ved at klikke på Send, anerkender du, at du kan blive kontaktet af Fisher Scientific med hensyn til den feedback, du har givet i denne formular. Vi deler ikke dine oplysninger til andre formål. Alle angivne kontaktoplysninger skal også vedligeholdes i overensstemmelse med vores Privatlivspolitik.