missing translation for 'onlineSavingsMsg'
Få mere at vide
  1. Home
  2. Products
  3. Antistoffer
  4. Primære antistoffer
  5. Alle primære antistoffer
  6. 30498837

NRAMP2/SLC11A2/DMT1 Antibody [Alexa Fluor« 594], Novus Biologicals Biologicals™

Artikelnummer. 30498837 Shop alle Bio Techne produkter
Skift visning
Klik for at se tilgængelige muligheder
Mængde:
0.1 mL
Pakningsstørrelse:
0.1ml
1 product options available for selection
Product selection table with 1 available options. Use arrow keys to navigate and Enter or Space to select.
Artikelnummer. Mængde unitSize
30498837 0.1 mL 0.1ml
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 1 options available.
1 options
Denne vare kan ikke returneres. Se returpolicy
Artikelnummer. 30498837 Leverandør Novus Biologicals Leverandørnr. NBP335108AF594

Venligst for at købe denne vare. Brug for en webkonto? Register dig hos os i dag!

Denne vare kan ikke returneres. Se returpolicy

Beskrivelse

Rabbit Polyclonal Antibody

NRAMP2/SLC11A2/DMT1 Polyclonal antibody specifically detects NRAMP2/SLC11A2/DMT1 in Human,Mouse,Rat samples. It is validated for ELISA,Immunohistochemistry,Western Blot,Immunohistochemistry (Paraffin)
TRUSTED_SUSTAINABILITY

Tekniske data

Antigen NRAMP2/SLC11A2/DMT1
Applikationer ELISA, Immunohistochemistry, Western Blot, Immunohistochemistry (Paraffin)
Klassifikation Polyclonal
Konjugeret Alexa Fluor 594
Formulering 50mM Sodium Borate
Gene Alias DCT1NRAMP 2, Divalent cation transporter 1, Divalent metal transporter 1, DMT-1, DMT1FLJ37416, member 2, NRAMP2natural resistance-associated macrophage protein 2, solute carrier family 11 (proton-coupled divalent metal ion transporters)
Værtsarter Rabbit
Immunogen Recombinant fusion protein containing a sequence corresponding to amino acids 1-63 of human NRAMP2/SLC11A2/DMT1 (NP_001167597.1).,, Sequence:, MVLGPEQKMSDDSVSGDHGESASLGNINPAYSNPSLSQSPGDSEEYFATYFNEKISIPEEEYS
Oprensningsmetode Affinity purified
Mængde 0.1 mL
Regulatorisk status RUO
Primær eller sekundær Primary
Gen-id (Entrez) 4891
Målarter Human, Mouse, Rat
Indhold og opbevaring Store at 4°C in the dark.
Produkttype Antibody
Form Purified
Isotype IgG
Vis mere Vis mindre
Produkttitel
Vælg et problem

Ved at klikke på Send, anerkender du, at du kan blive kontaktet af Fisher Scientific med hensyn til den feedback, du har givet i denne formular. Vi deler ikke dine oplysninger til andre formål. Alle angivne kontaktoplysninger skal også vedligeholdes i overensstemmelse med vores Privatlivspolitik.