missing translation for 'onlineSavingsMsg'
Få mere at vide
  1. Home
  2. Products
  3. Antistoffer
  4. Primære antistoffer
  5. Alle primære antistoffer
  6. 30498798

Aquaporin 1/AQP1 Antibody [HRP], Novus Biologicals Biologicals™

Artikelnummer. 30498798 Shop alle Bio Techne produkter
Skift visning
Klik for at se tilgængelige muligheder
Mængde:
0.1 mL
Pakningsstørrelse:
0.1ml
1 product options available for selection
Product selection table with 1 available options. Use arrow keys to navigate and Enter or Space to select.
Artikelnummer. Mængde unitSize
30498798 0.1 mL 0.1ml
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 1 options available.
1 options
Denne vare kan ikke returneres. Se returpolicy
Artikelnummer. 30498798 Leverandør Novus Biologicals Leverandørnr. NBP335493H

Venligst for at købe denne vare. Brug for en webkonto? Register dig hos os i dag!

Denne vare kan ikke returneres. Se returpolicy

Beskrivelse

Rabbit Polyclonal Antibody

Aquaporin 1/AQP1 Polyclonal antibody specifically detects Aquaporin 1/AQP1 in Human,Mouse,Rat samples. It is validated for ELISA,Immunohistochemistry,Western Blot,Immunohistochemistry (Paraffin),Immunocytochemistry/ Immunofluorescence
TRUSTED_SUSTAINABILITY

Tekniske data

Antigen Aquaporin 1/AQP1
Applikationer ELISA, Immunohistochemistry, Western Blot, Immunohistochemistry (Paraffin), Immunocytochemistry/Immunofluorescence
Klassifikation Polyclonal
Konjugeret HRP
Formulering PBS
Gene Alias 28-kDa, AQP-1, AQP-CHIP, aquaporin 1 (channel-forming integral protein, 28kDa), aquaporin 1 (Colton blood group), Aquaporin-CHIP, CHIP2828kDa, CO blood group), CO, MGC26324
Værtsarter Rabbit
Immunogen A synthetic peptide corresponding to a sequence within amino acids 200-269 of human Aquaporin 1/AQP1 (AQP1) (NP_932766.1).,, Sequence:, AVITHNFSNHWIFWVGPFIGGALAVLIYDFILAPRSSDLTDRVKVWTSGQVEEYDLDADDINSRVEMKPK
Oprensningsmetode Affinity purified
Mængde 0.1 mL
Regulatorisk status RUO
Forskningsdisciplin Cancer, Endocrinology, Signal Transduction
Primær eller sekundær Primary
Gen-id (Entrez) 358
Målarter Human, Mouse, Rat
Indhold og opbevaring Store at 4°C in the dark.
Produkttype Antibody
Form Purified
Isotype IgG
Vis mere Vis mindre
Produkttitel
Vælg et problem

Ved at klikke på Send, anerkender du, at du kan blive kontaktet af Fisher Scientific med hensyn til den feedback, du har givet i denne formular. Vi deler ikke dine oplysninger til andre formål. Alle angivne kontaktoplysninger skal også vedligeholdes i overensstemmelse med vores Privatlivspolitik.