missing translation for 'onlineSavingsMsg'
Få mere at vide
  1. Home
  2. Products
  3. Antistoffer
  4. Primære antistoffer
  5. Alle primære antistoffer
  6. 30498797

SMCX Antibody [DyLight 680], Novus Biologicals Biologicals™

Artikelnummer. 30498797 Shop alle Bio Techne produkter
Skift visning
Klik for at se tilgængelige muligheder
Mængde:
0.1 mL
Pakningsstørrelse:
0.1ml
1 product options available for selection
Product selection table with 1 available options. Use arrow keys to navigate and Enter or Space to select.
Artikelnummer. Mængde unitSize
30498797 0.1 mL 0.1ml
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 1 options available.
1 options
Denne vare kan ikke returneres. Se returpolicy
Artikelnummer. 30498797 Leverandør Novus Biologicals Leverandørnr. NBP335594FR

Venligst for at købe denne vare. Brug for en webkonto? Register dig hos os i dag!

Denne vare kan ikke returneres. Se returpolicy

Beskrivelse

Rabbit Polyclonal Antibody

SMCX Polyclonal antibody specifically detects SMCX in Human,Mouse,Rat samples. It is validated for ELISA,Western Blot
TRUSTED_SUSTAINABILITY

Tekniske data

Antigen SMCX
Applikationer ELISA, Western Blot
Klassifikation Polyclonal
Konjugeret DyLight 680
Formulering 50mM Sodium Borate
Gene Alias DXS1272EMRXJ, EC 1.14.11, EC 1.14.11.-, Histone demethylase JARID1C, JARID1Clysine-specific demethylase 5C, jumonji, AT rich interactive domain 1C, Jumonji, AT rich interactive domain 1C (RBP2-like), Jumonji/ARID domain-containing protein 1C, lysine (K)-specific demethylase 5C, MRXSJ, Protein SmcX, Protein Xe169, Smcx homolog, X chromosome, SMCXselected cDNA on X, Smcy homolog, X-linked, Smcy homolog, X-linked (mouse), XE169JmjC domain-containing protein SMCX
Værtsarter Rabbit
Immunogen A synthetic peptide corresponding to a sequence within amino acids 1400 to the C-terminus of human SMCX (XP_011529128.1).,, Sequence:, ERHGSRARGRALERRRRRKVDRGGEGDDPAREELEPKRVRSSGPEAEEVQEEEELEEETGGEGPPAPIPTTGSPSTQENQNGLEPAEGTTSGPSAPFSTLTPRLHLPCPQQPPQQQL
Oprensningsmetode Affinity purified
Mængde 0.1 mL
Regulatorisk status RUO
Primær eller sekundær Primary
Gen-id (Entrez) 8242
Målarter Human, Mouse, Rat
Indhold og opbevaring Store at 4°C in the dark.
Produkttype Antibody
Form Purified
Isotype IgG
Vis mere Vis mindre
Produkttitel
Vælg et problem

Ved at klikke på Send, anerkender du, at du kan blive kontaktet af Fisher Scientific med hensyn til den feedback, du har givet i denne formular. Vi deler ikke dine oplysninger til andre formål. Alle angivne kontaktoplysninger skal også vedligeholdes i overensstemmelse med vores Privatlivspolitik.