missing translation for 'onlineSavingsMsg'
Få mere at vide
  1. Home
  2. Products
  3. Antistoffer
  4. Primære antistoffer
  5. Alle primære antistoffer
  6. 30498760

HEY1 Antibody [Alexa Fluor« 700], Novus Biologicals Biologicals™

Artikelnummer. 30498760 Shop alle Bio Techne produkter
Skift visning
Klik for at se tilgængelige muligheder
Mængde:
0.1 mL
Pakningsstørrelse:
0.1ml
1 product options available for selection
Product selection table with 1 available options. Use arrow keys to navigate and Enter or Space to select.
Artikelnummer. Mængde unitSize
30498760 0.1 mL 0.1ml
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 1 options available.
1 options
Denne vare kan ikke returneres. Se returpolicy
Artikelnummer. 30498760 Leverandør Novus Biologicals Leverandørnr. NBP335645AF700

Venligst for at købe denne vare. Brug for en webkonto? Register dig hos os i dag!

Denne vare kan ikke returneres. Se returpolicy

Beskrivelse

Rabbit Polyclonal Antibody

HEY1 Polyclonal antibody specifically detects HEY1 in Human,Mouse,Rat samples. It is validated for ELISA,Western Blot,Immunocytochemistry/ Immunofluorescence
TRUSTED_SUSTAINABILITY

Tekniske data

Antigen HEY1
Applikationer ELISA, Western Blot, Immunocytochemistry/Immunofluorescence
Klassifikation Polyclonal
Konjugeret Alexa Fluor 700
Formulering 50mM Sodium Borate
Gene Alias basic helix-loop-helix protein OAF1, BHLHb31, Cardiovascular helix-loop-helix factor 2, CHF-2, CHF2hHRT1, Class B basic helix-loop-helix protein 31, Hairy and enhancer of split-related protein 1, hairy/enhancer-of-split related with YRPW motif 1, hairy/enhancer-of-split related with YRPW motif protein 1, Hairy-related transcription factor 1, HERP2HES-related repressor protein 1, HESR-1, HESR1MGC1274, HES-related repressor protein 2, HRT1, HRT-1OAF1
Værtsarter Rabbit
Immunogen A synthetic peptide corresponding to a sequence within amino acids 114-129 of human HEY1 (NP_001269780.1).,, Sequence:, IIEGLDASDPLRVRLVSHLNNYASQREAASGAHAGLGHIPWGTVFGHHPHIAHPLLLPQNGHGNAGTTASPTEPHHQGRLGSAHPEAPALRAPPSGSLGPV
Oprensningsmetode Affinity purified
Mængde 0.1 mL
Regulatorisk status RUO
Forskningsdisciplin DNA Repair, DNA replication Transcription Translation and Splicing, Neuroscience, Transcription Factors and Regulators
Primær eller sekundær Primary
Gen-id (Entrez) 23462
Målarter Human, Mouse, Rat
Indhold og opbevaring Store at 4°C in the dark.
Produkttype Antibody
Form Purified
Isotype IgG
Vis mere Vis mindre
Produkttitel
Vælg et problem

Ved at klikke på Send, anerkender du, at du kan blive kontaktet af Fisher Scientific med hensyn til den feedback, du har givet i denne formular. Vi deler ikke dine oplysninger til andre formål. Alle angivne kontaktoplysninger skal også vedligeholdes i overensstemmelse med vores Privatlivspolitik.