missing translation for 'onlineSavingsMsg'
Få mere at vide
  1. Home
  2. Products
  3. Antistoffer
  4. Primære antistoffer
  5. Alle primære antistoffer
  6. 30498663

NCF4 Antibody [Alexa Fluor« 405], Novus Biologicals Biologicals™

Artikelnummer. 30498663 Shop alle Bio Techne produkter
Skift visning
Klik for at se tilgængelige muligheder
Mængde:
0.1 mL
Pakningsstørrelse:
0.1ml
1 product options available for selection
Product selection table with 1 available options. Use arrow keys to navigate and Enter or Space to select.
Artikelnummer. Mængde unitSize
30498663 0.1 mL 0.1ml
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 1 options available.
1 options
Denne vare kan ikke returneres. Se returpolicy
Artikelnummer. 30498663 Leverandør Novus Biologicals Leverandørnr. NBP337904AF405

Venligst for at købe denne vare. Brug for en webkonto? Register dig hos os i dag!

Denne vare kan ikke returneres. Se returpolicy

Beskrivelse

Rabbit Polyclonal Antibody

NCF4 Polyclonal antibody specifically detects NCF4 in Human,Mouse,Rat samples. It is validated for ELISA,Western Blot
TRUSTED_SUSTAINABILITY

Tekniske data

Antigen NCF4
Applikationer ELISA, Western Blot
Klassifikation Polyclonal
Konjugeret Alexa Fluor 405
Formulering 50mM Sodium Borate
Gene Alias MGC3810, NCF, NCF-4, neutrophil cytosol factor 4, neutrophil cytosolic factor 4 (40kD), neutrophil cytosolic factor 4, 40kDa, Neutrophil NADPH oxidase factor 4, p40phox, p40-phox, SH3 and PX domain-containing protein 4, SH3PXD4P40PHOX
Værtsarter Rabbit
Immunogen A synthetic peptide corresponding to a sequence within amino acids 1-190 of human NCF4 (NP_038202.2).,, Sequence:, EIAEMRIPALNAYMKSLLSLPVWVLMDEDVRIFFYQSPYDSEQVPQALRRLRPRTRKVKSVSPQGNSVDRMAAPRAEALFDFTGNSKLELNFKAGDVIFLL
Oprensningsmetode Affinity purified
Mængde 0.1 mL
Regulatorisk status RUO
Forskningsdisciplin Signal Transduction
Primær eller sekundær Primary
Gen-id (Entrez) 4689
Målarter Human, Mouse, Rat
Indhold og opbevaring Store at 4°C in the dark.
Produkttype Antibody
Form Purified
Isotype IgG
Vis mere Vis mindre
Produkttitel
Vælg et problem

Ved at klikke på Send, anerkender du, at du kan blive kontaktet af Fisher Scientific med hensyn til den feedback, du har givet i denne formular. Vi deler ikke dine oplysninger til andre formål. Alle angivne kontaktoplysninger skal også vedligeholdes i overensstemmelse med vores Privatlivspolitik.