missing translation for 'onlineSavingsMsg'
Få mere at vide
Få mere at vide
Beskrivelse
CRMP1 Polyclonal antibody specifically detects CRMP1 in Human,Mouse,Rat samples. It is validated for ELISA,Western Blot,Immunocytochemistry/ Immunofluorescence
Tekniske data
Tekniske data
| Antigen | CRMP1 |
| Applikationer | ELISA, Western Blot, Immunocytochemistry/Immunofluorescence |
| Klassifikation | Polyclonal |
| Konjugeret | Alexa Fluor 647 |
| Formulering | 50mM Sodium Borate |
| Gene Alias | collapsin response mediator protein 1DRP1, CRMP-1, dihydropyrimidinase-like 1, dihydropyrimidinase-related protein 1, DPYSL1DRP-1dihydropyrimidinase related protein-1, ULIP3, ULIP-3, Unc-33-like phosphoprotein 3 |
| Værtsarter | Rabbit |
| Immunogen | Recombinant fusion protein containing a sequence corresponding to amino acids 460-540 of human CRMP1 (NP_001304.1).,, Sequence:, NVNKGMGRFIPRKAFPEHLYQRVKIRNKVFGLQGVSRGMYDGPVYEVPATPKYATPAPSAKSSPSKHQPPPIRNLHQSNFS |
| Oprensningsmetode | Affinity purified |
| Mængde | 0.1 mL |
| Show More |
Product Title
By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.
Spot an opportunity for improvement?