missing translation for 'onlineSavingsMsg'
Få mere at vide
  1. Home
  2. Products
  3. Antistoffer
  4. Primære antistoffer
  5. Alle primære antistoffer
  6. 30498636

CKII alpha prime polypeptide Antibody [Alexa Fluor« 405], Novus Biologicals Biologicals™

Artikelnummer. 30498636 Shop alle Bio Techne produkter
Skift visning
Klik for at se tilgængelige muligheder
Mængde:
0.1 mL
1 product options available for selection
Product selection table with 1 available options. Use arrow keys to navigate and Enter or Space to select.
Artikelnummer. Mængde
30498636 0.1 mL
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 1 options available.
1 options
Denne vare kan ikke returneres. Se returpolicy
Artikelnummer. 30498636 Leverandør Novus Biologicals Leverandørnr. NBP335650AF405

Venligst for at købe denne vare. Brug for en webkonto? Register dig hos os i dag!

Denne vare kan ikke returneres. Se returpolicy

Beskrivelse

Rabbit Polyclonal Antibody

CKII alpha prime polypeptide Polyclonal antibody specifically detects CKII alpha prime polypeptide in Human,Mouse,Rat samples. It is validated for ELISA,Western Blot,Immunocytochemistry/ Immunofluorescence
TRUSTED_SUSTAINABILITY

Tekniske data

Antigen CKII alpha prime polypeptide
Applikationer ELISA, Western Blot, Immunocytochemistry/Immunofluorescence
Klassifikation Polyclonal
Konjugeret Alexa Fluor 405
Formulering 50mM Sodium Borate
Gene Alias casein kinase 2, alpha prime polypeptide, casein kinase II subunit alpha', CK II alpha', CK2A2, CSNK2A1, EC 2.7.11, EC 2.7.11.1, FLJ43934
Værtsarter Rabbit
Immunogen A synthetic peptide corresponding to a sequence within amino acids 250-350 of human CKII alpha prime polypeptide (NP_001887.1).,, Sequence:, LGTEELYGYLKKYHIDLDPHFNDILGQHSRKRWENFIHSENRHLVSPEALDLLDKLLRYDHQQRLTAKEAMEHPYFYPVVKEQSQPCADNAVLSSGLTAAR
Oprensningsmetode Affinity purified
Mængde 0.1 mL
Regulatorisk status RUO
Forskningsdisciplin Protein Kinase, Wnt Signaling Pathway
Primær eller sekundær Primary
Gen-id (Entrez) 1459
Målarter Human, Mouse, Rat
Indhold og opbevaring Store at 4°C in the dark.
Produkttype Antibody
Form Purified
Isotype IgG
Vis mere Vis mindre
Produkttitel
Vælg et problem

Ved at klikke på Send, anerkender du, at du kan blive kontaktet af Fisher Scientific med hensyn til den feedback, du har givet i denne formular. Vi deler ikke dine oplysninger til andre formål. Alle angivne kontaktoplysninger skal også vedligeholdes i overensstemmelse med vores Privatlivspolitik.