missing translation for 'onlineSavingsMsg'
Få mere at vide
  1. Home
  2. Products
  3. Antistoffer
  4. Primære antistoffer
  5. Alle primære antistoffer
  6. 30498633

TLE4 Antibody [DyLight 350], Novus Biologicals Biologicals™

Artikelnummer. 30498633 Shop alle Bio Techne produkter
Skift visning
Klik for at se tilgængelige muligheder
Mængde:
0.1 mL
Pakningsstørrelse:
0.1ml
1 product options available for selection
Product selection table with 1 available options. Use arrow keys to navigate and Enter or Space to select.
Artikelnummer. Mængde unitSize
30498633 0.1 mL 0.1ml
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 1 options available.
1 options
Denne vare kan ikke returneres. Se returpolicy
Artikelnummer. 30498633 Leverandør Novus Biologicals Leverandørnr. NBP335294UV

Venligst for at købe denne vare. Brug for en webkonto? Register dig hos os i dag!

Denne vare kan ikke returneres. Se returpolicy

Beskrivelse

Rabbit Polyclonal Antibody

TLE4 Polyclonal antibody specifically detects TLE4 in Rat samples. It is validated for ELISA,Western Blot
TRUSTED_SUSTAINABILITY

Tekniske data

Antigen TLE4
Applikationer ELISA, Western Blot
Klassifikation Polyclonal
Konjugeret DyLight 350
Formulering 50mM Sodium Borate
Gene Alias BCE1, BCE-1, E(spI), ESG4, homolog of Drosophila E(sp1), KIAA1261, Protein BCE-1, transducin-like enhancer of split 4 (E(sp1) homolog, Drosophila), transducin-like enhancer protein 4
Værtsarter Rabbit
Immunogen Recombinant fusion protein containing a sequence corresponding to amino acids 173-243 of human TLE4 (NP_001269677).,, Sequence:, SSALGGQSHLPIKDEKKHHDNDHQRDRDSIKSSSVSPSASFRGAEKHRNSADYSSESKKQKTEEKEIAARY
Oprensningsmetode Affinity purified
Mængde 0.1 mL
Regulatorisk status RUO
Forskningsdisciplin Signal Transduction
Primær eller sekundær Primary
Gen-id (Entrez) 7091
Målarter Rat
Indhold og opbevaring Store at 4°C in the dark.
Produkttype Antibody
Form Purified
Isotype IgG
Vis mere Vis mindre
Produkttitel
Vælg et problem

Ved at klikke på Send, anerkender du, at du kan blive kontaktet af Fisher Scientific med hensyn til den feedback, du har givet i denne formular. Vi deler ikke dine oplysninger til andre formål. Alle angivne kontaktoplysninger skal også vedligeholdes i overensstemmelse med vores Privatlivspolitik.