missing translation for 'onlineSavingsMsg'
Få mere at vide
  1. Home
  2. Products
  3. Antistoffer
  4. Primære antistoffer
  5. Alle primære antistoffer
  6. 30498632

CRM1 Antibody [DyLight 680], Novus Biologicals Biologicals™

Artikelnummer. 30498632 Shop alle Bio Techne produkter
Skift visning
Klik for at se tilgængelige muligheder
Mængde:
0.1 mL
Pakningsstørrelse:
0.1ml
1 product options available for selection
Product selection table with 1 available options. Use arrow keys to navigate and Enter or Space to select.
Artikelnummer. Mængde unitSize
30498632 0.1 mL 0.1ml
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 1 options available.
1 options
Denne vare kan ikke returneres. Se returpolicy
Artikelnummer. 30498632 Leverandør Novus Biologicals Leverandørnr. NBP335072FR

Venligst for at købe denne vare. Brug for en webkonto? Register dig hos os i dag!

Denne vare kan ikke returneres. Se returpolicy

Beskrivelse

Rabbit Polyclonal Antibody

CRM1 Polyclonal antibody specifically detects CRM1 in Human,Mouse samples. It is validated for ELISA,Western Blot
TRUSTED_SUSTAINABILITY

Tekniske data

Antigen CRM1
Applikationer ELISA, Western Blot
Klassifikation Polyclonal
Konjugeret DyLight 680
Formulering 50mM Sodium Borate
Gene Alias Chromosome region maintenance 1 protein homolog, DKFZp686B1823, emb, exp1, exportin 1 (CRM1 homolog, yeast), exportin 1 (CRM1, yeast, homolog), exportin-1, Exportin-1 (required for chromosome region maintenance), yeast, homolog
Værtsarter Rabbit
Immunogen A synthetic peptide corresponding to a sequence within amino acids 964-1064 of human CRM1 (NP_003391.1).,, Sequence:, PGNPVNNQIFLQEYVANLLKSAFPHLQDAQVKLFVTGLFSLNQDIPAFKEHLRDFLVQIKEFAGEDTSDLFLEEREIALRQADEEKHKRQMSVPGIFNPHE
Oprensningsmetode Affinity purified
Mængde 0.1 mL
Regulatorisk status RUO
Forskningsdisciplin Core ESC Like Genes, Stem Cell Markers
Primær eller sekundær Primary
Gen-id (Entrez) 7514
Målarter Human, Mouse
Indhold og opbevaring Store at 4°C in the dark.
Produkttype Antibody
Form Purified
Isotype IgG
Vis mere Vis mindre
Produkttitel
Vælg et problem

Ved at klikke på Send, anerkender du, at du kan blive kontaktet af Fisher Scientific med hensyn til den feedback, du har givet i denne formular. Vi deler ikke dine oplysninger til andre formål. Alle angivne kontaktoplysninger skal også vedligeholdes i overensstemmelse med vores Privatlivspolitik.