missing translation for 'onlineSavingsMsg'
Få mere at vide
  1. Home
  2. Products
  3. Antistoffer
  4. Primære antistoffer
  5. Alle primære antistoffer
  6. 30498619

Hemoglobin beta Antibody [PerCP], Novus Biologicals Biologicals™

Artikelnummer. 30498619 Shop alle Bio Techne produkter
Skift visning
Klik for at se tilgængelige muligheder
Mængde:
0.1 mL
Pakningsstørrelse:
0.1ml
1 product options available for selection
Product selection table with 1 available options. Use arrow keys to navigate and Enter or Space to select.
Artikelnummer. Mængde unitSize
30498619 0.1 mL 0.1ml
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 1 options available.
1 options
Denne vare kan ikke returneres. Se returpolicy
Artikelnummer. 30498619 Leverandør Novus Biologicals Leverandørnr. NBP335330PCP

Venligst for at købe denne vare. Brug for en webkonto? Register dig hos os i dag!

Denne vare kan ikke returneres. Se returpolicy

Beskrivelse

Rabbit Polyclonal Antibody

Hemoglobin beta Polyclonal antibody specifically detects Hemoglobin beta in Human,Rat samples. It is validated for ELISA,Western Blot
TRUSTED_SUSTAINABILITY

Tekniske data

Antigen Hemoglobin beta
Applikationer ELISA, Western Blot
Klassifikation Polyclonal
Konjugeret PerCP
Formulering PBS
Gene Alias beta globin chain, beta-globin, CD113t-C, HBBB, HBD, Hemoglobin beta chain, hemoglobin subunit beta, hemoglobin, beta
Værtsarter Rabbit
Immunogen A synthetic peptide corresponding to a sequence within amino acids 47-147 of human Hemoglobin beta (NP_000509.1).,, Sequence:, GDLSTPDAVMGNPKVKAHGKKVLGAFSDGLAHLDNLKGTFATLSELHCDKLHVDPENFRLLGNVLVCVLAHHFGKEFTPPVQAAYQKVVAGVANALAHKYH
Oprensningsmetode Affinity purified
Mængde 0.1 mL
Regulatorisk status RUO
Primær eller sekundær Primary
Gen-id (Entrez) 3043
Målarter Human, Rat
Indhold og opbevaring Store at 4°C in the dark.
Produkttype Antibody
Form Purified
Isotype IgG
Vis mere Vis mindre
Produkttitel
Vælg et problem

Ved at klikke på Send, anerkender du, at du kan blive kontaktet af Fisher Scientific med hensyn til den feedback, du har givet i denne formular. Vi deler ikke dine oplysninger til andre formål. Alle angivne kontaktoplysninger skal også vedligeholdes i overensstemmelse med vores Privatlivspolitik.