missing translation for 'onlineSavingsMsg'
Learn More
Learn More
HIV-1 Gag p24 Antibody (8G9), mFluor Violet 450 SE, Novus Biologicals™
Mouse Monoclonal Antibody
Brand: Novus Biologicals NBP2-41336MFV450
This item is not returnable.
View return policy
Description
HIV-1 Gag p24 Monoclonal antibody specifically detects HIV-1 Gag p24 in Virus samples. It is validated for Western Blot, ELISA
Specifications
HIV-1 Gag p24 | |
Monoclonal | |
mFluor Violet 450 SE | |
50mM Sodium Borate | |
Antibody was raised against a recombinant full-length HIV-1 Gag p24 protein. Amino Acid Squence: pivqniqgqmvhqaisprtlnawvkvveekafspevipmfsalsegatpqdlntmlntvgghqaamqmlketineeaaewdrvhpvhagpiapgqmreprgsdiagttstlqeqigwmtnnppipvgeiykrwiilglnkivrmysptsildirqgpkepfrdyvdrfyktlraeqasqevknwmtetllvqnanpdcktilkalgpaatleemmtacqgvggpghkarvla | |
0.1 mL | |
Infections (Virus Bacteria and Parasites) | |
155030 | |
Store at 4C in the dark. | |
IgG1 |
Western Blot, ELISA | |
8G9 | |
Western Blot, ELISA | |
Mouse | |
Protein A purified | |
RUO | |
Primary | |
Virus | |
Purified |
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title
HIV-1 Gag p24 Antibody (8G9), mFluor Violet 450 SE, Novus Biologicals™ > 0.1 mL; mFluor Violet 450 SE
Spot an opportunity for improvement?Share a Content Correction