missing translation for 'onlineSavingsMsg'
Learn More
Learn More
Novus Biologicals LHX6 Antibody (3D9), Novus Biologicals™
Mouse Monoclonal Antibody
Brand: Novus Biologicals H00026468-M01
Additional Details : Weight : 0.00970kg
Description
LHX6 Monoclonal antibody specifically detects LHX6 in Human, Mouse, Rat samples. It is validated for Western Blot, ELISA, Immunocytochemistry/ Immunofluorescence, Immunohistochemistry (Frozen)Specifications
| LHX6 | |
| Monoclonal | |
| Unconjugated | |
| In 1x PBS, pH 7.4 | |
| LHX6.1LIM homeobox protein 6, LIM homeobox 6, LIM homeodomain protein 6.1, LIM/homeobox protein Lhx6, LIM/homeobox protein Lhx6.1, MGC119542, MGC119544, MGC119545 | |
| LHX6 (NP_055183, 274 a.a. ~ 363 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. HKKHTPQHPVPPSGAPPSRLPSALSDDIHYTPFSSPERARMVTLHGYIESQVQCGQVHCRLPYTAPPVHLKADMDGPLSNRGEKVILFQY | |
| 0.1 mg | |
| Primary | |
| Human, Mouse, Rat | |
| Purified |
| Western Blot, ELISA, Immunocytochemistry, Immunohistochemistry (Frozen) | |
| 3D9 | |
| Western Blot 1:500, ELISA 1:100-1:2000, Immunocytochemistry/ Immunofluorescence, Immunohistochemistry-Frozen | |
| NP_055183 | |
| Mouse | |
| Protein A purified | |
| RUO | |
| 26468 | |
| Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles. | |
| IgG2b κ |