Alle primære antistoffer
Primære antistoffer, immunoglobuliner, der binder til specifikke proteiner eller andre biomolekyler, bruges i mange forskningsapplikationer og protokoller til at påvise mål af interesse. De er udviklet ved hjælp af forskellige dyreværter, herunder mus, rotte, kanin, ged, får og mange andre.
Monoklonale
og polyklonale antistoffer En type primære antistoffer, monoklonale antistoffer, giver høj reproducerbarhed og lav krydsreaktivitet og baggrundsstøj. En anden type, polyklonale antistoffer, koster ofte mindre og giver større affinitet og hurtigere binding. Begge er produceret ved hjælp af plasma B-celler, men førstnævnte bruger den samme klon, og sidstnævnte bruger forskellige kloner. Monoklonale antistoffer kræver hybridomcellelinjer, og polyklonale antistoffer gør det ikke.
Der er også rekombinante monoklonale antistoffer med lignende fordele, såsom høj affinitet, skalerbarhed og specificitet. De er produceret vha in vitro kloning af plasma B-celler og ekspressionsværter.
Konjugerede primære
antistoffer Antistoffer kan mærkes med forskellige fluoroforer eller detektionsmidler eller anvendes uden mærker. Mærkede primære antistoffer, også kendt som konjugerede primære antistoffer, hjælper forskere med at forenkle og strømline deres applikationer. De er koblet med almindelige enzymer og farvestoffer såsom Alexa Fluor og bruges ofte i protein- og celleanalyse.
Anvendelser Antistoffer til biovidenskabsapplikationer bruges i flowcytometri, western blotting, ELISA, immunhistokemi og immuncytokemi. Sekundære antistoffer kan tilsættes for at understøtte påvisning og oprensning af visse antigener. De binder til det primære antistof, som binder til antigenet af interesse. At finde den rigtige kombination af antistoffer kan resultere i større antigenspecificitet og et stærkt, detekterbart signal.
- (983)
- (16)
- (141)
- (483)
- (3)
- (4)
- (329)
- (74)
- (1)
- (788)
- (3)
- (2)
- (7)
- (2)
- (124)
- (2)
- (5)
- (93)
- (135)
- (53)
- (744)
- (2)
- (5)
- (4,552)
- (5,866)
- (2)
- (2)
- (28)
- (27)
- (11)
- (6)
- (1)
- (137)
- (233)
- (1)
- (74)
- (2)
- (1)
- (8,699)
- (43)
- (419)
- (1,468)
- (6)
- (348)
- (2)
- (1)
- (147)
- (1)
- (9)
- (10)
- (62)
- (2)
- (23)
- (630)
- (30)
- (8)
- (82,357)
- (2)
- (57)
- (46)
- (182)
- (18)
- (657)
- (4,033)
- (2)
- (3)
- (3)
- (1,329)
- (6)
- (8)
- (388,529)
- (28)
- (11,999)
- (10,790)
- (1,525)
- (374)
- (215)
- (77)
- (5,822)
- (4)
- (170)
- (25)
- (2)
- (28)
- (927)
- (7)
- (2)
- (15)
- (18)
- (1)
- (182)
- (10)
- (303,669)
- (2,540)
- (30,295)
- (83)
- (2)
- (50)
- (50)
- (1)
- (4)
- (139)
- (2)
- (23,508)
- (96)
- (1)
- (134)
- (824)
- (11,500)
- (3)
- (2)
- (163)
- (25)
- (2)
- (9)
- (761)
- (2)
- (2)
- (72)
- (29)
- (3)
- (309)
- (1,232)
- (2,371)
- (4)
- (245,695)
- (143,088)
- (153)
- (28)
- (186,503)
- (465,243)
- (2)
- (2)
- (3)
- (75)
- (1,309)
- (37,330)
- (14)
- (244)
- (12,291)
- (516,651)
- (203)
- (1)
- (543)
- (2)
- (3)
- (372)
- (6)
- (4)
- (169,404)
- (2,178)
- (3)
- (49)
- (507)
- (3)
- (657)
- (1,069)
- (1,274)
- (6)
- (8)
- (976)
- (4)
- (3)
- (50)
- (10,860)
- (6)
- (721)
- (34)
- (9)
- (2)
- (389)
- (4)
- (3)
- (2)
- (22)
- (46)
- (1,202)
- (2)
- (19)
- (1,799)
- (1)
- (4)
- (250)
- (451)
- (821)
- (34)
- (24,799)
- (22)
- (1)
- (92)
- (78)
- (779)
- (1,948)
- (5)
- (2)
- (3)
- (2)
- (21,605)
- (13)
- (2)
- (4)
- (1,295)
- (6)
- (2)
- (2)
- (1)
- (136)
- (2)
- (2,387)
- (93)
- (3)
- (12)
- (23)
- (1,102)
- (1)
- (4)
- (2)
- (5,904)
- (4,040)
- (3,224)
- (1)
- (11)
- (5,205)
- (2)
- (450)
- (428)
- (3)
- (22)
- (32)
- (9)
- (2,560)
- (168)
- (1)
- (3)
- (13)
- (44)
- (1)
- (2)
- (3)
- (1)
- (2)
- (925,364)
- (3)
- (8,252)
- (46)
- (10)
- (90)
- (1)
- (8)
- (776,246)
- (6)
- (3)
- (630,187)
- (30,776)
- (62)
- (545)
- (1)
- (2)
- (1)
- (3,044)
- (875)
- (2,291)
- (4,151)
- (1)
- (1)
- (1)
- (1,299)
- (974)
- (810,672)
- (11,452)
- (9)
- (833)
- (54)
- (1)
- (5)
- (1)
- (4,916)
- (835)
- (1,520)
- (196)
- (1)
- (4)
- (4,089)
- (883)
- (6)
- (4)
- (408)
- (4)
- (1)
- (9,402)
- (8,867)
- (2)
- (1)
- (1)
- (5)
- (1)
- (256)
- (145)
- (54)
- (1)
- (1)
- (1)
- (117)
- (413)
- (3)
- (1)
- (12)
- (269)
- (1)
- (166,048)
- (219,669)
- (1)
- (1)
- (805)
- (11,221)
- (1)
- (2)
- (9)
- (10)
- (2)
- (6)
- (20)
- (1)
- (12)
- (34)
- (15)
- (4)
- (1)
- (103)
- (1)
- (1)
- (20)
- (14)
- (35)
- (1)
- (3)
- (12,768)
- (635)
- (1)
- (2)
- (10)
- (2)
- (187)
- (343)
- (219)
- (81)
- (1)
- (1)
- (6)
- (23,642)
- (2)
- (5,136)
- (2)
- (64)
- (1)
- (10)
- (1)
- (4,642)
- (3,144)
- (1)
- (75)
- (1)
- (1)
- (1)
- (2)
- (6)
- (16,735)
- (17,078)
- (1)
- (5,752)
- (285)
- (15)
- (14)
- (1)
- (145)
- (626)
- (19)
- (1)
- (1)
- (1)
- (2)
- (2,128)
- (1)
- (3)
- (1)
- (6)
- (2)
- (1)
- (1)
- (13,007)
- (2)
- (20)
- (1)
- (109)
- (1)
- (1)
- (5)
- (1)
- (2)
- (21)
- (1)
- (4)
- (40)
- (4,901)
- (7)
- (2)
- (2)
- (5)
- (4)
- (20)
- (251)
- (2)
- (12,297)
- (34,905)
- (1,009)
- (52)
- (1,691)
- (282)
- (7)
- (1)
- (9)
- (2,678)
- (1)
- (4,398)
- (84)
- (38)
- (1)
- (10)
- (1)
- (4)
- (35)
- (1)
- (1,001)
- (1)
- (1)
- (21)
- (6)
- (4)
- (7)
- (2)
- (6)
- (1)
- (2)
- (565)
- (2,760)
- (22)
- (1)
- (15)
- (1,726)
- (2)
- (2)
- (2)
- (5)
- (5)
- (57,214)
- (72)
- (102)
- (6)
- (1,526)
- (21,267)
- (35)
- (51)
- (3)
- (115)
- (8)
- (22)
- (571,802)
- (1)
- (7)
- (8)
- (686,632)
- (62,817)
- (5)
- (29,187)
- (186)
- (1)
- (1)
- (25,855)
- (9)
- (4)
- (1)
- (10)
- (2,869)
- (66)
- (105)
- (301)
- (1)
- (4)
- (2)
- (1)
- (20)
- (31,274)
- (31,361)
- (6)
- (32,872)
- (16)
- (30,967)
- (213)
- (48)
- (18)
- (31,461)
- (2)
- (32,786)
- (1)
- (3)
- (1)
- (74)
- (3)
- (31,747)
- (31,254)
- (3)
- (17,378)
- (17,338)
- (17,225)
- (17,393)
- (17,191)
- (23)
- (106)
- (5)
- (16)
- (97)
- (97)
- (62)
- (16)
- (33,056)
- (11)
- (222)
- (718)
- (948)
- (623)
- (702)
- (827)
- (772)
- (892)
- (737)
- (1,279)
- (807)
- (739)
- (914)
- (954)
- (938)
- (1)
- (614)
- (951)
- (31)
- (8)
- (27,423)
- (839)
- (5)
- (124)
- (4)
- (657)
- (6)
- (149)
- (81)
- (49)
- (309)
- (13)
- (5)
- (3)
- (13)
- (4)
- (18)
- (1)
- (26,923)
- (26,946)
- (27,071)
- (43)
- (26,987)
- (26,908)
- (40)
- (26,942)
- (26,939)
- (26,924)
- (8)
- (10)
- (17)
- (18)
- (30,586)
- (3)
- (5)
- (42)
- (1)
- (4)
- (3)
- (4)
- (237)
- (1,273)
- (27,674)
- (14,111)
- (25,958)
- (4,866)
- (4,867)
- (25,938)
- (14,068)
- (7)
- (7)
- (13)
- (1)
- (182)
- (32)
- (55)
- (103)
- (56)
- (220)
- (278)
- (53)
- (152)
- (62)
- (24)
- (56)
- (84)
- (30)
- (123)
- (126)
- (167)
- (142)
- (134)
- (27)
- (68)
- (70)
- (44)
- (58)
- (103)
- (95)
- (177)
- (220)
- (73)
- (102)
- (118)
- (126)
- (80)
- (449)
- (27,248)
- (7)
- (5)
- (261)
- (379)
- (2,762)
- (3,758)
- (24)
- (30)
- (265)
- (2,697)
- (2)
- (1)
- (127)
- (43)
- (22,848)
- (588)
- (612)
- (4)
- (14)
- (13)
- (5)
- (7)
- (62)
- (59)
- (872)
- (95)
- (9)
- (480)
- (749)
- (35)
- (13)
- (64)
- (32)
- (478)
- (660)
- (648)
- (5)
- (39)
- (1)
- (370)
- (327)
- (169)
- (176)
- (115)
- (38)
- (17)
- (5)
- (5)
- (9)
- (3)
- (10)
- (2)
- (67)
- (5)
- (4)
- (477,701)
- (278)
- (49)
- (441)
- (83)
- (56)
- (28)
- (320)
- (1)
- (23,824)
- (23,810)
- (23,792)
Filtrerede søgeresultater
Invitrogen™ CD86 Monoclonal Antibody (GL-1)
Greener Choice Product
This product offers one or more environmental benefits itemized in the U.S. FTC Green Guides.
Learn More About the Greener Choice Program
This product offers one or more environmental benefits itemized in the U.S. FTC Green Guides.
Learn More About the Greener Choice Program
Rat Monoclonal Antibody
Invitrogen™ GATA3 Monoclonal Antibody (A3G6)
Greener Choice Product
This product offers one or more environmental benefits itemized in the U.S. FTC Green Guides.
Learn More About the Greener Choice Program
This product offers one or more environmental benefits itemized in the U.S. FTC Green Guides.
Learn More About the Greener Choice Program
Mouse Monoclonal Antibody
B7-2/CD86 Antibody (AP-MAB0803) - Azide and BSA Free, Novus Biologicals™
Rat Monoclonal Antibody has been used in 2 publications
| Klon | AP-MAB0803 |
|---|---|
| Værtsarter | Rat |
| Form | Purified |
| Konjugeret | Unconjugated |
| Isotype | IgG2 |
| Koncentration | 0.5 mg/mL |
| Fortynding | Flow Cytometry 1:100-1000, Immunohistochemistry 1:-300-2000, Immunocytochemistry/Immunofluorescence 1:10-1:500, Immunohistochemistry-Paraffin 1:-300-2000, CyTOF-ready |
| Primær eller sekundær | Primary |
| Klassifikation | Monoclonal |
| Antigen | B7-2/CD86 |
| Gene Alias | Activation B7-2 antigen, B70, B7-2, B7-2 antigen, B-lymphocyte activation antigen B7-2, BU63, CD28 antigen ligand 2, CD28LG2B7-2 antigen), CD86 antigen, CD86 molecule, CTLA-4 counter-receptor B7.2, FUN-1, LAB72, MGC34413, T-lymphocyte activation antigen CD86 |
| Gensymboler | CD86 |
| Applikationer | CyTOF,Flow Cytometry,Immunocytochemistry/Immunofluorescence,Immunohistochemistry,Immunohistochemistry (Paraffin) |
| Indhold og opbevaring | Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
| Immunogen | Mouse CD86 |
| Formulering | A 0.2 um filtered solution in PBS with No Preservative |
| Målarter | Mouse |
| Gen-id (Entrez) | 942 |
| Oprensningsmetode | Protein G purified |
| Forskningsdisciplin | Adaptive Immunity, Cell Cycle and Replication, Dendritic Cell Markers, Diabetes Research, Immunology |
Invitrogen™ GAPDH Loading Control Monoclonal Antibody (GA1R), DyLight™ 680
Greener Choice Product
This product offers one or more environmental benefits itemized in the U.S. FTC Green Guides.
Learn More About the Greener Choice Program
This product offers one or more environmental benefits itemized in the U.S. FTC Green Guides.
Learn More About the Greener Choice Program
Mouse Monoclonal Antibody
| Værtsarter | Rabbit |
|---|---|
| Form | Purified |
| Konjugeret | Unconjugated |
| Isotype | IgG |
| Fortynding | Western Blot 1:500-1:2000, Immunocytochemistry/ Immunofluorescence 1:100-1:500, Immunoprecipitation 1-5ul/mg of lysate |
| Primær eller sekundær | Primary |
| Klassifikation | Polyclonal |
| Antigen | NXF1 |
| Gene Alias | DKFZp667O0311, Mex67, mRNA export factor TAP, nuclear RNA export factor 1, TAPMEX67, tip associating protein, Tip-associated protein, Tip-associating protein |
| Applikationer | Immunocytochemistry/Immunofluorescence,Immunoprecipitation,Western Blot |
| Indhold og opbevaring | Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles. |
| Immunogen | Produced in rabbits immunized with E. coli-derived Human NXF1 fragment. |
| Formulering | PBS, pH7.0 |
| Målarter | Human |
| Regulatorisk status | RUO |
| Gen-id (Entrez) | 10482 |
| Oprensningsmetode | Antigen and protein A Affinity-purified |
| Værtsarter | Rabbit |
|---|---|
| Form | Purified |
| Konjugeret | Unconjugated |
| Isotype | IgG |
| Fortynding | Western Blot 1:500 - 1:1000, ELISA |
| Primær eller sekundær | Primary |
| Klassifikation | Polyclonal |
| Antigen | NXF1 |
| Gene Alias | DKFZp667O0311, Mex67, mRNA export factor TAP, nuclear RNA export factor 1, TAPMEX67, tip associating protein, Tip-associated protein, Tip-associating protein |
| Applikationer | ELISA,Western Blot |
| Indhold og opbevaring | Store at -20°C. Avoid freeze-thaw cycles. |
| Immunogen | A synthetic peptide corresponding to a sequence within amino acids 200-300 of human NXF1 (NP_006353.2).,, Sequence:, ILNELKPEQVEQLKLIMSKRYDGSQQALDLKGLRSDPDLVAQNIDVVLNRRSCMAATLRIIEENIPELLSLNLSNNRLYRLDDMSSIVQKAPNLKILNLSG |
| Formulering | PBS (pH 7.3), 50% glycerol |
| Målarter | Human,Mouse,Rat |
| Regulatorisk status | RUO |
| Gen-id (Entrez) | 10482 |
| Oprensningsmetode | Affinity purified |
Invitrogen™ beta Actin Loading Control Monoclonal Antibody (BA3R), DyLight™ 680
Greener Choice Product
This product offers one or more environmental benefits itemized in the U.S. FTC Green Guides.
Learn More About the Greener Choice Program
This product offers one or more environmental benefits itemized in the U.S. FTC Green Guides.
Learn More About the Greener Choice Program
Mouse Monoclonal Antibody
| Klon | IG266 |
|---|---|
| Form | Purified |
| Værtsarter | Mouse |
| Konjugeret | Unconjugated |
| Isotype | IgG2a κ |
| Klassifikation | Monoclonal |
| Primær eller sekundær | Primary |
| Antigen | IgG |
| Gene Alias | immunoglobulin heavy constant gamma 1 (G1m marker) |
| Applikationer | ELISA,Flow Cytometry,Immunocytochemistry,Immunofluorescence,Immunohistochemistry,Immunohistochemistry (Paraffin),Protein Array,RNA Immunoprecipitation,Western Blot |
| Indhold og opbevaring | Store at 4C. |
| Immunogen | Purified human Ig Gamma Chain |
| Regulatorisk status | RUO |
| Formulering | PBS with 0.05% BSA. with 0.05% Sodium Azide |
| Målarter | Human |
| Gen-id (Entrez) | 3500 |
| Oprensningsmetode | Protein A purified |
| Klon | SR1919 |
|---|---|
| Værtsarter | Rabbit |
| Form | Purified |
| Konjugeret | Unconjugated |
| Isotype | IgG |
| Fortynding | Western Blot 1:500-1:2000, Immunohistochemistry 1:50-1:200 |
| Primær eller sekundær | Primary |
| Klassifikation | Monoclonal |
| Antigen | IgG |
| Gene Alias | Immunoglobulin G, ImmunoglobulinG |
| Applikationer | Immunohistochemistry,Western Blot |
| Indhold og opbevaring | Store at -20° C. Avoid freeze/thaw cycles. |
| Immunogen | A synthesized peptide derived from human IgG (Uniprot #: P01857, P01859, P01860, P01861) |
| Formulering | PBS, pH 7.4, 150mM NaCl, 50% glycerol. |
| Målarter | Human |
| Regulatorisk status | RUO |
| Gen-id (Entrez) | 3500 |
| Oprensningsmetode | Affinity purified |
| Forskningsdisciplin | Adaptive Immunity, Epitope Tags, Immunology |
| Klon | E20-V |
|---|---|
| Værtsarter | Rabbit |
| Form | Purified |
| Konjugeret | Unconjugated |
| Isotype | IgG |
| Fortynding | Immunohistochemistry 1:100-1:300, Immunohistochemistry-Paraffin 1:100-1:300 |
| Primær eller sekundær | Primary |
| Klassifikation | Monoclonal |
| Antigen | IgG |
| Gene Alias | Immunoglobulin G, ImmunoglobulinG |
| Applikationer | Immunohistochemistry,Immunohistochemistry (Paraffin) |
| Indhold og opbevaring | Store at 4°C. |
| Immunogen | Peptide derived from internal domain of human IgG-1 chain C region. Antibody recognizes the epitope betweenVal167 - Val185. |
| Formulering | 20 mM Tris-HCl, pH 8.0, 20 mg/ml BSA |
| Målarter | Human |
| Regulatorisk status | RUO |
| Gen-id (Entrez) | 3500 |
| Oprensningsmetode | Immunogen affinity purified |
| Forskningsdisciplin | Adaptive Immunity, Epitope Tags, Immunology |
Human IgG Antibody, R&D Systems™
Greener Choice Product
This product offers one or more environmental benefits itemized in the U.S. FTC Green Guides.
Learn More About the Greener Choice Program
This product offers one or more environmental benefits itemized in the U.S. FTC Green Guides.
Learn More About the Greener Choice Program
Rabbit Monoclonal Antibody
| Klon | 1268C |
|---|---|
| Rekonstitution | Reconstitute at 0.5mg/mL in sterile PBS. |
| Værtsarter | Rabbit |
| Form | Supernatant |
| Konjugeret | Unconjugated |
| Isotype | IgG |
| Fortynding | ELISA |
| Primær eller sekundær | Primary |
| Klassifikation | Monoclonal |
| Antigen | IgG |
| Gene Alias | Immunoglobulin G, ImmunoglobulinG |
| Applikationer | ELISA |
| Indhold og opbevaring | Use a manual defrost freezer and avoid repeated freeze-thaw cycles. 12 months from date of receipt, -20 to -70 degreesC as supplied. 1 month, 2 to 8 degreesC under sterile conditions after reconstitution. 6 months, -20 to -70 degreesC under sterile conditions after reconstitution. |
| Immunogen | Purified IgG from human serum |
| Formulering | Lyophilized from a 0.2μm filtered solution in PBS with Trehalose. *Small pack size (SP) is supplied as a 0.2μm filtered solution in PBS. |
| Målarter | Human |
| Gen-id (Entrez) | 3500 |
| Testspecificitet | Detects human IgG in direct ELISAs. As a pan-Human IgG-specific antibody, sandwich immunoassay specificity is determined by the capture antibody. |
| Oprensningsmetode | Protein A or G purified from cell culture supernatant |
| Klon | ICO-97 |
|---|---|
| Form | Purified |
| Værtsarter | Mouse |
| Konjugeret | Unconjugated |
| Isotype | IgG1 κ |
| Klassifikation | Monoclonal |
| Primær eller sekundær | Primary |
| Antigen | IgG |
| Gene Alias | immunoglobulin heavy constant gamma 1 (G1m marker) |
| Applikationer | ELISA,Flow Cytometry,Immunocytochemistry,Immunofluorescence |
| Indhold og opbevaring | Store at 4C. |
| Immunogen | Purified human Ig Gamma Chain |
| Regulatorisk status | RUO |
| Formulering | PBS with 0.05% BSA. with 0.05% Sodium Azide |
| Målarter | Human |
| Gen-id (Entrez) | 3500 |
| Oprensningsmetode | Protein A purified |