Sequence: DTEPVELNCNFSFSRKRKMSCTICGHKFPRKSQLLEHMYTHKGKSYRYNRCQRFGNALAQRFQPYCDSWSDVSLKSSRLSQEHLDLPCALESELTQENVDTILVE
KUP/ZNF46; Zinc finger and BTB domain-containing protein 25; Zinc finger protein 46; Zinc finger protein KUP
Cat # 16167765
200 uL
Cat # 16834205
150 µL
Cat # 15827403
100 µL
Cat # 16147765
100 µg
Cat # 16177765
100 µg
Cat # 16187765
100 µg
Cat # 16541072
100 µL
Cat # 16844205
20 µL
Cat # 16551072
100 µL
Cat # 16157765
50 µg
Cat # 15750792
100 µL
Cat # 15652395
100 µg
Searching for an antibody we don't offer? We make custom antibodies for specific targets, species and applications.
More than 18,000 custom antibodies created so far.
Talk To A Specialist NowIf an Invitrogen™ antibody doesn’t perform as described on our website or datasheet, we’ll replace the product at no cost to you, or provide you with a credit for a future purchase.*
Get expert recommendations for common problems or connect directly with an on staff expert for technical assistance related to applications, equipment and general product use.