Sequence: KKGEVQTVASTQDLRVQNGGTAPPVASSEGTTTSLPTELGDCEIVLLVNGELPEAEQNGEVGRQPEPQVSSEAESALSSVGCIADSHPEMESVDLITKNNQTELETSNNRENNTVSNIHPKLS
FLJ13426/MGC133303/ZNF-U69274; Zinc finger and BTB domain-containing protein 11
Cat # 16133820
100 uL
Cat # 15744826
100 ul
Cat # 15722921
100 µL
Cat # 15781241
100 µL
Cat # 16883775
20 µL
Cat # 17157113
100 µL
Cat # 16873775
150 µL
Cat # 16174510
100 uL
Searching for an antibody we don't offer? We make custom antibodies for specific targets, species and applications.
More than 18,000 custom antibodies created so far.
Talk To A Specialist NowIf an Invitrogen™ antibody doesn’t perform as described on our website or datasheet, we’ll replace the product at no cost to you, or provide you with a credit for a future purchase.*
Get expert recommendations for common problems or connect directly with an on staff expert for technical assistance related to applications, equipment and general product use.