Sequence: SSWVQDGSPEMAENESEGQTKVFIWNNMGSQGIQETGKTRRKNQTTKRFIYNIPPNNETNLEDCSVMQPPVAYPEENTLLIKEEPDLDGALLSGPD
FLJ12752/RINZF; Zinc finger and BTB domain-containing protein 10; Zinc finger protein RIN ZF; zinc finger protein RINZF
Cat # 16174320
100 uL
Cat # 15742381
100 µL
Cat # 16892135
150 µL
Cat # 17161504
100 µL
Cat # 16802145
20 µL
Cat # 16300975
100 µL
Searching for an antibody we don't offer? We make custom antibodies for specific targets, species and applications.
More than 18,000 custom antibodies created so far.
Talk To A Specialist NowIf an Invitrogen™ antibody doesn’t perform as described on our website or datasheet, we’ll replace the product at no cost to you, or provide you with a credit for a future purchase.*
Get expert recommendations for common problems or connect directly with an on staff expert for technical assistance related to applications, equipment and general product use.