Sequence: RLSPNFREAVTLSRDCPVPLPGDGDLLVRNRFVGVNASDINYSAGRYDPSVKPPFDIGFEGIGEVVALGLSASARYTVGQAVAYMAPGSFAEYTVVPASIATPVPS
MGC45594; PRG-3; Prostaglandin reductase 3; Zinc-binding alcohol dehydrogenase domain-containing protein 2
Cat # 16144310
100 uL
Cat # 16883434
20 µL
Cat # 15536431
100 µg
Cat # 16873434
150 µL
Cat # 15928544
100 µL
Cat # 15742351
100 µL
Cat # 15583901
100 µL
Cat # 16643215
100 µL
Searching for an antibody we don't offer? We make custom antibodies for specific targets, species and applications.
More than 18,000 custom antibodies created so far.
Talk To A Specialist NowIf an Invitrogen™ antibody doesn’t perform as described on our website or datasheet, we’ll replace the product at no cost to you, or provide you with a credit for a future purchase.*
Get expert recommendations for common problems or connect directly with an on staff expert for technical assistance related to applications, equipment and general product use.