Sequence: VRSQMQKHQKVPTAVLLSALEETAWLFNLRASDIPYNPFFYSYTLLTDSSIRLFANKSRFSSETLSYLNSSCTGPMCVQIEDYSQVRDSIQAYSLGDVRIWIGTSYTMYGI
Aminoacylproline aminopeptidase; mAmP; Membrane-bound aminopeptidase P; membrane-bound AmP; Membrane-bound APP; X-Pro aminopeptidase 2; X-prolyl aminopeptidase (aminopeptidase P) 2, membrane-bound; Xaa-Pro aminopeptidase 2
Cat # 16124030
100 uL
Cat # 15503822
100 µg
Cat # 16354494
100 µL
Cat # 17178925
100 µL
Cat # 15817553
100 µL
Cat # 16308844
100 µL
Cat # 16824485
20 µL
Cat # 16344494
100 µL
Cat # 15593812
100 µg
Cat # 16814485
150 µL
Cat # 13269558
100 µL
Cat # 16556161
100 µL
Cat # 15577822
100 µg
Cat # 16334494
100 µL
Cat # 15933125
100 µL
Searching for an antibody we don't offer? We make custom antibodies for specific targets, species and applications.
More than 18,000 custom antibodies created so far.
Talk To A Specialist NowIf an Invitrogen™ antibody doesn’t perform as described on our website or datasheet, we’ll replace the product at no cost to you, or provide you with a credit for a future purchase.*
Get expert recommendations for common problems or connect directly with an on staff expert for technical assistance related to applications, equipment and general product use.