Sequence: RVSTEVAQLKEQTLARLLDIEEAVHKALSSMSSLQPEASARGHFQGPPKDHSAHKISVTVSSSARPSGSGQEVGGQTAVKNQAKVECHTEAQSQVKIRNHT
cardiomyopathy associated 1; Cardiomyopathy-associated protein 1; CMYA1/DKFZp451D042/DKFZp779C1255/DKFZp779C1947/Xin; xin actin-binding repeat containing 1; Xin actin-binding repeat-containing protein 1
Cat # 16164100
100 uL
Cat # 15781421
100 µL
Cat # 15741741
100 µL
Cat # 16144080
100 uL
Cat # 15622905
400 µL
Searching for an antibody we don't offer? We make custom antibodies for specific targets, species and applications.
More than 18,000 custom antibodies created so far.
Talk To A Specialist NowIf an Invitrogen™ antibody doesn’t perform as described on our website or datasheet, we’ll replace the product at no cost to you, or provide you with a credit for a future purchase.*
Get expert recommendations for common problems or connect directly with an on staff expert for technical assistance related to applications, equipment and general product use.