Sequence: DIQTEEIETREVWTQHPGESTVVSGGSEQRDTSDAVVMPKIDTPRLCSFLRAACQVMAVLLEEDRLAAEPSWNLRAQDRALYFSDSSSQLNTSLPFLQNRKVSSLHTSRVQRQMVVSVH
Cytoplasmic dynein 2 intermediate chain 1; Dynein 2 intermediate chain 1; FLJ10300/FLJ23575; testicular secretory protein Li 66; WD repeat-containing protein 60
Cat # 16184220
100 uL
Cat # 15712181
100 µL
Cat # 15732311
100 µL
Cat # 16124290
100 uL
Searching for an antibody we don't offer? We make custom antibodies for specific targets, species and applications.
More than 18,000 custom antibodies created so far.
Talk To A Specialist NowIf an Invitrogen™ antibody doesn’t perform as described on our website or datasheet, we’ll replace the product at no cost to you, or provide you with a credit for a future purchase.*
Get expert recommendations for common problems or connect directly with an on staff expert for technical assistance related to applications, equipment and general product use.