Sequence: LDWVTKKLMCEINVMEAVRDIRFLHSEALLAVAQNRWLHIYDNQGIELHCIRRCDRVTRLEFLPFHFLLATASETGFLTYLDVSVGKIVAALNARAGRLDVMSQNPYNAVIHL
BING4/C6orf11/FP221; WD repeat-containing protein 46; WD repeat-containing protein BING4
Cat # 16106610
100 uL
Cat # 16874134
20 µL
Cat # 16864134
150 µL
Cat # 15819013
100 µL
Cat # 16662825
100 µL
Cat # 15758031
100 µL
Searching for an antibody we don't offer? We make custom antibodies for specific targets, species and applications.
More than 18,000 custom antibodies created so far.
Talk To A Specialist NowIf an Invitrogen™ antibody doesn’t perform as described on our website or datasheet, we’ll replace the product at no cost to you, or provide you with a credit for a future purchase.*
Get expert recommendations for common problems or connect directly with an on staff expert for technical assistance related to applications, equipment and general product use.