Sequence: MALHSMRKARERWSFIRALHKGSAAAPALQKDSKKRVFSGIQPTGILHLGNYLGAIESWVRLQDEYDSVLYSIVDLHSITVPQDPAVLRQSILDMTAVLLACGINPEKSILFQQSQVSEHTQLSWILSCMVRLPRLQHLHQWKAKTTKQKHDGTVGLLTYPVLQAADILLYKSTHVPVGEDQVQHMELVQDLAQGFNKKYGEFFPVPESILSMCVLVFLT
(Mt)TrpRS; TrpRS; tryptophan tRNA ligase 2, mitochondrial; Tryptophan--tRNA ligase, mitochondrial; Tryptophanyl-tRNA synthetase
Cat # 16186908
100 µg
Cat # 16822384
150 µL
Cat # 16697284
100 µL
Cat # 15989734
100 µL
Cat # 16176908
100 µL
Cat # 16166908
50 µg
Cat # 15596242
100 µL
Cat # 16015235
100 µg
Cat # 16832384
20 µL
Searching for an antibody we don't offer? We make custom antibodies for specific targets, species and applications.
More than 18,000 custom antibodies created so far.
Talk To A Specialist NowIf an Invitrogen™ antibody doesn’t perform as described on our website or datasheet, we’ll replace the product at no cost to you, or provide you with a credit for a future purchase.*
Get expert recommendations for common problems or connect directly with an on staff expert for technical assistance related to applications, equipment and general product use.