Sequence: MSSPSPGKRRMDTDVVKLIESKHEVTILGGLNEFVVKFYGPQGTPYEGGVWKVRVDLPDKYPFKSPSIGFMNKIFHPNIDEASGTVCLDVINQTWTALYDLTNIFESFLPQLLAYPNPIDPLNGDAAAMYLHRPEEYKQKIKEYIQKYATEEALKEQEEGTGDSSSESSMSDFSEDEAQDMEL
(E3-independent) E2 ubiquitin-conjugating enzyme H; E2 ubiquitin-conjugating enzyme H; E2-20K/UBC8/UBCH/UBCH2; GID complex subunit 3, UBC8 homolog; UbcH2; Ubiquitin carrier protein H; ubiquitin conjugating enzyme E2H; Ubiquitin-conjugating enzyme E2 H; Ubiquitin-conjugating enzyme E2-20K; ubiquitin-conjugating enzyme E2H (homologous to yeast UBC8); ubiquitin-conjugating enzyme E2H (UBC8 homolog, yeast); Ubiquitin-protein ligase H
Cat # 16161692
100 µg
Cat # 16589481
100 µL
Cat # 16884964
150 µL
Cat # 15847623
100 µL
Cat # 17130004
100 µL
Cat # 16171692
200 uL
Cat # 16078847
400 uL
Cat # 15913715
100 µL
Cat # 16894964
20 µL
Cat # 15837623
100 µL
Searching for an antibody we don't offer? We make custom antibodies for specific targets, species and applications.
More than 18,000 custom antibodies created so far.
Talk To A Specialist NowIf an Invitrogen™ antibody doesn’t perform as described on our website or datasheet, we’ll replace the product at no cost to you, or provide you with a credit for a future purchase.*
Get expert recommendations for common problems or connect directly with an on staff expert for technical assistance related to applications, equipment and general product use.