Sequence: MSTEAQRVDDSPSTSGGSSDGDQRESVQQEPEREQVQPKKKEGKISSKTAAKLSTSAKRIQKELAEITLDPPPNCSAGPKGDNIYEWRSTILGPPGSVYEGGVFFLDITFSPDYPFKPPKVTFRTRIYHCNINSQGVICLDILKDNWSPALTISKVLLSICSLLTDCNPADPLVGSIATQYMTNRAEHDRMARQWTKRYAT
E2 ubiquitin-conjugating enzyme E2; FLJ25157/UBCH8; UbcH8; Ubiquitin carrier protein E2; ubiquitin conjugating enzyme E2E 2; Ubiquitin-conjugating enzyme E2 E2; ubiquitin-conjugating enzyme E2E 2 (homologous to yeast UBC4/5); ubiquitin-conjugating enzyme E2E 2 (UBC4/5 homolog, yeast); Ubiquitin-protein ligase E2
Cat # 16101692
100 µg
Cat # 15575412
100 µL
Cat # 15743911
100 µL
Cat # 15662935
400 µL
Cat # 16879183
20 µL
Cat # 16632885
100 µL
Cat # 16869183
150 µL
Searching for an antibody we don't offer? We make custom antibodies for specific targets, species and applications.
More than 18,000 custom antibodies created so far.
Talk To A Specialist NowIf an Invitrogen™ antibody doesn’t perform as described on our website or datasheet, we’ll replace the product at no cost to you, or provide you with a credit for a future purchase.*
Get expert recommendations for common problems or connect directly with an on staff expert for technical assistance related to applications, equipment and general product use.