Sequence: MADEEEDPTFEEENEEIGGGAEGGQGKRKRLFSKELRCMMYGFGDDQNPYTESVDILEDLVIEFITEMTHKAMSIGRQGRVQVEDIVFLIRKDPRKFARVKDLLTMNEELKRARKAFDEANYGS
MGC22425/TAF2K/TAFII18; TAF(II)18; TAF13 RNA polymerase II, TATA box binding protein (TBP)-associated factor, 18kDa; TATA box binding protein (TBP)-associated factor, RNA polymerase II, K, 18kD; TATA box binding protein associated factor 13; transcription initiation factor TFIID 18 kD subunit; Transcription initiation factor TFIID 18 kDa subunit; Transcription initiation factor TFIID subunit 13
Cat # 16123398
50 µg
Cat # 16133398
100 µg
Cat # 16823165
20 µL
Cat # 15528862
100 µg
Cat # 15792526
50 µL
Cat # 16813165
150 µL
Cat # 16126245
100 µg
Cat # 15748551
100 µL
Cat # 16590062
100 µL
Cat # 15555601
100 µg
Searching for an antibody we don't offer? We make custom antibodies for specific targets, species and applications.
More than 18,000 custom antibodies created so far.
Talk To A Specialist NowIf an Invitrogen™ antibody doesn’t perform as described on our website or datasheet, we’ll replace the product at no cost to you, or provide you with a credit for a future purchase.*
Get expert recommendations for common problems or connect directly with an on staff expert for technical assistance related to applications, equipment and general product use.