Sequence: VEVECSSLQEAVQAAEAGADLVLLDNFKPEELHPTATVLKAQFPSVAVEASGGITLDNLPQFCGPHIDVISMGMLTQAAPALDFSLKLFAKEVAPVPKIH
epididymis secretory sperm binding protein Li 90n; nicotinate-nucleotide pyrophosphorylase (carboxylating); Nicotinate-nucleotide pyrophosphorylase [carboxylating]; QAPRTase; QPRTase; Quinolinate phosphoribosyltransferase [decarboxylating]
Cat # 16174736
100 µg
Cat # 16144736
50 uL
Cat # 15954804
100 µL
Cat # 16134736
50 ug
Cat # 15934804
100 µL
Cat # 15790811
100 µL
Cat # 17118183
100 µL
Cat # 15944804
100 µL
Cat # 16813735
150 µL
Cat # 15984814
100 µL
Cat # 16823735
20 µL
Searching for an antibody we don't offer? We make custom antibodies for specific targets, species and applications.
More than 18,000 custom antibodies created so far.
Talk To A Specialist NowIf an Invitrogen™ antibody doesn’t perform as described on our website or datasheet, we’ll replace the product at no cost to you, or provide you with a credit for a future purchase.*
Get expert recommendations for common problems or connect directly with an on staff expert for technical assistance related to applications, equipment and general product use.