Sequence: MAAQPLRHRSRCATPPRGDFCGGTERAIDQASFTTSMEWDTQVVKGSSPLGPAGLGAEEPAAGPQLPSWLQPERCAVFQCAQCHAVLADSVHLAWDLSRSLGAVVFSRVTNNVVLEAPFLVGIEGSLKGSTYNLLFCGSCGIPVGFHLYSTHAALAALRGHFCLSSDKMVCYLLKTKAIVNASEMDIQNVPLSEKIAELKEKIVLTHNRLKSLMKILSEVTPDQSKPEN
5730547N13Rik/LINT-25/MIS18beta; Cancer/testis antigen 86; CT86; LAP2alpha interactor-25; MIS18 kinetochore protein homolog B; OIP-5; Opa-interacting protein 5; Protein Mis18-beta
Cat # 16144106
100 µg
Cat # 16157200
100 uL
Cat # 15928984
100 µL
Cat # 16124106
50 µg
Cat # 15956924
100 µL
Cat # 15936924
100 µL
Cat # 16602775
100 µL
Cat # 16134106
100 µL
Cat # 16889673
150 µL
Cat # 15750372
100 µL
Cat # 16808365
150 µL
Cat # 16899673
20 µL
Cat # 16186572
100 µg
Cat # 16176572
50 uL
Cat # 15996924
100 µL
Cat # 16818365
20 µL
Searching for an antibody we don't offer? We make custom antibodies for specific targets, species and applications.
More than 18,000 custom antibodies created so far.
Talk To A Specialist NowIf an Invitrogen™ antibody doesn’t perform as described on our website or datasheet, we’ll replace the product at no cost to you, or provide you with a credit for a future purchase.*
Get expert recommendations for common problems or connect directly with an on staff expert for technical assistance related to applications, equipment and general product use.