Sequence: PGPKYLIPPTTGFMKHTPTKLRAPAYSFRGAPMLLAENCSPGPRYNVNPKILRTGKDLGPAYSILGRYQTKTMLTP
cancer/testis antigen 135; Outer dense fiber of sperm tails protein 3; Outer dense fiber protein 3; SHIPPO1/TISP50/hSHIPPO; Sperm tail protein SHIPPO 1; sperm tail protein SHIPPO1; Transcript induced in spermiogenesis protein 50
Cat # 16135940
100 uL
Cat # 15786581
100 µL
Cat # 16853635
150 µL
Cat # 15716471
100 µL
Cat # 16863635
20 µL
Searching for an antibody we don't offer? We make custom antibodies for specific targets, species and applications.
More than 18,000 custom antibodies created so far.
Talk To A Specialist NowIf an Invitrogen™ antibody doesn’t perform as described on our website or datasheet, we’ll replace the product at no cost to you, or provide you with a credit for a future purchase.*
Get expert recommendations for common problems or connect directly with an on staff expert for technical assistance related to applications, equipment and general product use.