Sequence: GKLWQLLALSPLENYSVNLSSHVDSTLLQVDLAGALVASGPSRPGREEHIVVELTQADALGSRWRRPQQVTHNWTVYLNPRRSEHSVMSRTFEVLTRETV
BEY/BEY1/BEY2/BOCA/D15S12/EYCL/EYCL2/EYCL3/HCL3/P/PED/SHEP1; eye color 2 (central brown); eye color 3 (brown); hair color 3 (brown); Melanocyte-specific transporter protein; oculocutaneous albinism II (pink-eye dilution homolog, mouse); P protein; P-protein; Pink-eyed dilution protein homolog; total brown iris pigmentation
Cat # 16192155
100 µg
Cat # 15764606
100 ul
Cat # 15963285
100 µL
Cat # 16609284
100 µL
Cat # 17187983
100 µL
Cat # 16531162
100 µg
Searching for an antibody we don't offer? We make custom antibodies for specific targets, species and applications.
More than 18,000 custom antibodies created so far.
Talk To A Specialist NowIf an Invitrogen™ antibody doesn’t perform as described on our website or datasheet, we’ll replace the product at no cost to you, or provide you with a credit for a future purchase.*
Get expert recommendations for common problems or connect directly with an on staff expert for technical assistance related to applications, equipment and general product use.