Sequence: KAGMGPYSSPSEQVLLGGPSHLASEEESQGRSAQPLPSTKTFAFQTQIQRGRFSVVRQCWEKASGRALAAKIIPYHPKDKTAVLREYEALKGLRHPHLA
DKFZp666E245/FLJ14124/KIAA1556/KIAA1639/MGC120409/MGC120410/MGC120411/MGC120412/MGC138590/UNC89; Obscurin; obscurin, myosin light chain kinase; Obscurin-MLCK; Obscurin-myosin light chain kinase; Obscurin-RhoGEF
Cat # 16160607
50 uL
Cat # 16846775
150 µL
Cat # 16170607
200 uL
Cat # 16125583
50 µg
Cat # 16856775
20 µL
Cat # 15722281
100 µL
Searching for an antibody we don't offer? We make custom antibodies for specific targets, species and applications.
More than 18,000 custom antibodies created so far.
Talk To A Specialist NowIf an Invitrogen™ antibody doesn’t perform as described on our website or datasheet, we’ll replace the product at no cost to you, or provide you with a credit for a future purchase.*
Get expert recommendations for common problems or connect directly with an on staff expert for technical assistance related to applications, equipment and general product use.