Sequence: MGTFDLWTDYLGLAHLVRALSGKEGPETRLSPQPEPEPMLEPVSALEPMPAPESVPVPGPKDQKRSLESSPAPERLCSFCKHNGESRAIYQSHVLKDEAG
MGC120114/NANOS1L/NOS3; Nanos homolog 3; NOS-3
Cat # 16190234
100 µg
Cat # 16080377
100 ug
Cat # 17278393
100 µL
Cat # 12868712
100 µg
Cat # 16821285
150 µL
Cat # 16831285
20 µL
Cat # 15711852
100 µL
Searching for an antibody we don't offer? We make custom antibodies for specific targets, species and applications.
More than 18,000 custom antibodies created so far.
Talk To A Specialist NowIf an Invitrogen™ antibody doesn’t perform as described on our website or datasheet, we’ll replace the product at no cost to you, or provide you with a credit for a future purchase.*
Get expert recommendations for common problems or connect directly with an on staff expert for technical assistance related to applications, equipment and general product use.