Sequence: LLKPELQVCVFCRNNKEAMALYTTHILKGPDGRVLCPVLRRYTCPLCGASGDNAHTIKYCPLSKV
EC_Rep1a; Nanos homolog 1; NOS-1; NOS1
Cat # 16142827
100 µg
Cat # 11396323
100 µg
Cat # 12868732
100 µg
Cat # 16025087
400 uL
Cat # 16020727
100 ug
Cat # 17151584
100 µL
Cat # 13257798
100 µg
Cat # 16010727
100 ug
Cat # 16079917
100 ug
Cat # 12858732
100 µg
Searching for an antibody we don't offer? We make custom antibodies for specific targets, species and applications.
More than 18,000 custom antibodies created so far.
Talk To A Specialist NowIf an Invitrogen™ antibody doesn’t perform as described on our website or datasheet, we’ll replace the product at no cost to you, or provide you with a credit for a future purchase.*
Get expert recommendations for common problems or connect directly with an on staff expert for technical assistance related to applications, equipment and general product use.