Sequence: EIFGPVAHPFYVLRFNSSDHIESKGIKIKETMYFAPSMKDFTQYIFTEKLKQDKGSDASWKNDQEPPPEALDFSDDEKEKEAKQRKKSQIQGRK
H/ACA ribonucleoprotein complex non-core subunit NAF1; hNAF1; nuclear assembly factor 1 homolog
Cat # 16175580
100 uL
Cat # 15949504
100 µL
Cat # 15705481
100 µL
Cat # 15795471
100 µL
Cat # 17259273
100 µL
Cat # 16835815
150 µL
Cat # 16845815
20 µL
Searching for an antibody we don't offer? We make custom antibodies for specific targets, species and applications.
More than 18,000 custom antibodies created so far.
Talk To A Specialist NowIf an Invitrogen™ antibody doesn’t perform as described on our website or datasheet, we’ll replace the product at no cost to you, or provide you with a credit for a future purchase.*
Get expert recommendations for common problems or connect directly with an on staff expert for technical assistance related to applications, equipment and general product use.