Sequence: KMGPYSMFCKLLGMWRHICTPRQVADKVKRFFSKYSMNRHKMTTLTPAYHAENYSPEDNRFDLRPFLYNTSWPWQFRCIENQVLQLERAEPQSLDGVD
FLJ10631/FLJ36703/FLJ40627; glutamine-dependent NAD synthetase; Glutamine-dependent NAD(+) synthetase; NAD(+) synthase; NAD(+) synthase [glutamine-hydrolyzing]; NAD(+) synthetase
Cat # 16197966
100 µg
Cat # 15987974
100 µL
Cat # 17146993
100 µL
Cat # 16187966
50 uL
Cat # 15977974
100 µL
Searching for an antibody we don't offer? We make custom antibodies for specific targets, species and applications.
More than 18,000 custom antibodies created so far.
Talk To A Specialist NowIf an Invitrogen™ antibody doesn’t perform as described on our website or datasheet, we’ll replace the product at no cost to you, or provide you with a credit for a future purchase.*
Get expert recommendations for common problems or connect directly with an on staff expert for technical assistance related to applications, equipment and general product use.