Sequence: MHRAPSPTAEQPPGGGDSARRTLQPRLKPSARAMALPRTLGELQLYRVLQRANLLSYYETFIQQGGDDVQQLCEAGEEEFLEIMALVGMATKPLHVRRLQKALREWATNPGLFSQPVPAVPVSSIPLFKISETAGTRKGSMSNGHGSPGEKAGSARSFSPKSPLELGEKLSPLPGGPGAGDPRIWPGRSTPESDVGAGGEEEAGSRWDWGWSRPTGARDGTPACLGRVWMDICRLWGHVQG
EGR-1-binding protein 2; EGR1 binding protein 2; MADER/MGC75085; Melanoma-associated delayed early response protein; NGFI-A binding protein 2 (EGR1 binding protein 2); NGFI-A-binding protein 2; Protein MADER
Cat # 16180508
100 µg
Cat # 16160508
50 ug
Cat # 16657654
100 µL
Cat # 15946224
100 µL
Cat # 16170508
100 µL
Cat # 15986234
100 µL
Cat # 16899114
20 µL
Cat # 15971845
100 µL
Cat # 16007107
100 uL
Cat # 13434637
100 µL
Cat # 16379934
100 µL
Cat # 15916234
100 µL
Cat # 13482037
100 µL
Cat # 16889114
150 µL
Cat # 16551222
100 µL
Cat # 16161635
100 ug
Searching for an antibody we don't offer? We make custom antibodies for specific targets, species and applications.
More than 18,000 custom antibodies created so far.
Talk To A Specialist NowIf an Invitrogen™ antibody doesn’t perform as described on our website or datasheet, we’ll replace the product at no cost to you, or provide you with a credit for a future purchase.*
Get expert recommendations for common problems or connect directly with an on staff expert for technical assistance related to applications, equipment and general product use.