Sequence: MTLLPGDNSDYDYSALSCTSDASFHPAFLPQRQAIKGAFY
K13/KCNG/KV6.1/MGC12878/kH2; kH2; potassium channel KH2; potassium channel Kv6.1; potassium channel, voltage gated modifier subfamily G, member 1; Potassium voltage-gated channel subfamily G member 1; potassium voltage-gated channel, subfamily G, member 1; Voltage-gated potassium channel subunit Kv6.1
Cat # 16196060
100 uL
Cat # 15746901
100 µL
Cat # 16146110
100 uL
Cat # 15674615
100 µL
Cat # 15736701
100 µL
Cat # 13433027
100 µL
Searching for an antibody we don't offer? We make custom antibodies for specific targets, species and applications.
More than 18,000 custom antibodies created so far.
Talk To A Specialist NowIf an Invitrogen™ antibody doesn’t perform as described on our website or datasheet, we’ll replace the product at no cost to you, or provide you with a credit for a future purchase.*
Get expert recommendations for common problems or connect directly with an on staff expert for technical assistance related to applications, equipment and general product use.