Sequence: MNCSESQRLRTLLSRLLLELHHRGNASGLGAGPRPSMGMGVVPDPFVGREVTSAKGDDA
AMME syndrome candidate gene 2 protein; AMMECR2 protein; cardiac voltage-gated potassium channel accessory subunit 5; KCNE1-like; KCNE5; Potassium channel subunit beta MiRP4; potassium channel, voltage gated subfamily E regulatory beta subunit 5; Potassium voltage-gated channel subfamily E member 1-like protein; Potassium voltage-gated channel subfamily E regulatory beta subunit 5; potassium voltage-gated channel, Isk-related family, member 1-like
Cat # 16014507
100 uL
Cat # 17172154
100 µL
Cat # 15767791
100 µL
Cat # 16650475
100 µL
Cat # 15813164
100 µL
Cat # 16802274
150 µL
Cat # 16812274
20 µL
Searching for an antibody we don't offer? We make custom antibodies for specific targets, species and applications.
More than 18,000 custom antibodies created so far.
Talk To A Specialist NowIf an Invitrogen™ antibody doesn’t perform as described on our website or datasheet, we’ll replace the product at no cost to you, or provide you with a credit for a future purchase.*
Get expert recommendations for common problems or connect directly with an on staff expert for technical assistance related to applications, equipment and general product use.