Sequence: IRWFEHEQNEREVHLPEIFAKCIRFPLMEDTFIEKIPPQFAQAIAKSCVEKGPSNTNGCTQRLGMTASEMIICFDAAHKHSGKKQTV
kelch repeat and BTB (POZ) domain containing 8; Kelch repeat and BTB domain-containing protein 8; KIAA1842/TA-KRP; T-cell activation kelch repeat protein; TA-KRP
Cat # 16136200
100 uL
Cat # 17289343
100 µL
Cat # 16341755
100 µL
Cat # 15717361
100 µL
Cat # 15566792
100 µL
Cat # 16325214
100 µL
Searching for an antibody we don't offer? We make custom antibodies for specific targets, species and applications.
More than 18,000 custom antibodies created so far.
Talk To A Specialist NowIf an Invitrogen™ antibody doesn’t perform as described on our website or datasheet, we’ll replace the product at no cost to you, or provide you with a credit for a future purchase.*
Get expert recommendations for common problems or connect directly with an on staff expert for technical assistance related to applications, equipment and general product use.