Sequence: APLLERLSQLDSCVHPVLAFPDDVPTSLHFQSMLKSQWQNKPFDKIKPPKKLSLKHRAPMPGSLPDSARKDRHKLVSSFLTTAKLSHHQTRPDRTHRQHLDDVGAVPMVERVTAPKAERLLNPPPPVHDPNHSKMRLRDHSS
CENP-36/KDVS/KIAA1267/MSL1v1/NSL1/hMSL1v1; centromere protein 36; hMSL1v1; KAT8 regulatory NSL complex subunit 1; male-specific lethal 1 homolog; MLL1/MLL complex subunit KANSL1; MSL1 homolog 1; Non-specific lethal 1 homolog; NSL complex protein NSL1
Cat # 16183440
100 uL
Cat # 15710311
100 µL
Cat # 15808503
100 µL
Cat # 15770351
100 µL
Cat # 16163450
100 uL
Cat # 16362395
100 µL
Searching for an antibody we don't offer? We make custom antibodies for specific targets, species and applications.
More than 18,000 custom antibodies created so far.
Talk To A Specialist NowIf an Invitrogen™ antibody doesn’t perform as described on our website or datasheet, we’ll replace the product at no cost to you, or provide you with a credit for a future purchase.*
Get expert recommendations for common problems or connect directly with an on staff expert for technical assistance related to applications, equipment and general product use.