Sequence: MSMTTRAWEELDGGLGSCQALEDHSALAETQEDRASATPRLADSGSVPHDSQVAEGPSVDTRPKKMEKEPAARGTPGTGKERLKAGASPRSVPARKKAQT
2310032K21Rik; FLJ32416/JP-45; homolog of mouse skeletal muscle sarcoplasmic reticulum protein JP-45; JP-45; Junctional sarcoplasmic reticulum protein 1; Junctional-face membrane protein of 45 kDa homolog; skeletal muscle sarcoplasmic reticulum protein JP-45
Cat # 16147713
100 µg
Cat # 16004637
100 uL
Cat # 15768631
100 µL
Cat # 11575812
100 µL
Cat # 15612345
100 µg
Searching for an antibody we don't offer? We make custom antibodies for specific targets, species and applications.
More than 18,000 custom antibodies created so far.
Talk To A Specialist NowIf an Invitrogen™ antibody doesn’t perform as described on our website or datasheet, we’ll replace the product at no cost to you, or provide you with a credit for a future purchase.*
Get expert recommendations for common problems or connect directly with an on staff expert for technical assistance related to applications, equipment and general product use.