Sequence: DVFVRKFQPERYKLWKAGKDNTVIDHTLPTPEAAEFLKESELPPRAGNEEECPEEDMEGVEDGEEGDLKTSLAKHRIGTKRHRVCLEIPQEVSQSELFPKEDLSSEQYEMTEC
[histone H3]-trimethyl-L-lysine(36) demethylase 4A; [histone H3]-trimethyl-L-lysine(9) demethylase 4A; JHDM3A/JMJD2/KDM4A/KIAA0677; JmjC domain-containing histone demethylation protein 3A; jumonji C domain-containing histone demethylase 3A; jumonji domain containing 2; jumonji domain containing 2A; Jumonji domain-containing protein 2A; lysine (K)-specific demethylase 4A; Lysine-specific demethylase 4A; tudor domain containing 14A
Cat # 16153470
100 uL
Cat # 16309274
100 µL
Cat # 15923854
100 µg
Cat # 16586801
100 µL
Cat # 13248178
100 µL
Cat # 16080476
100 uL
Cat # 16579711
100 µL
Cat # 16342455
100 µL
Cat # 11365643
100 µL
Cat # 17218243
100 µL
Cat # 12838982
100 µg
Cat # 11540401
100 µL
Searching for an antibody we don't offer? We make custom antibodies for specific targets, species and applications.
More than 18,000 custom antibodies created so far.
Talk To A Specialist NowIf an Invitrogen™ antibody doesn’t perform as described on our website or datasheet, we’ll replace the product at no cost to you, or provide you with a credit for a future purchase.*
Get expert recommendations for common problems or connect directly with an on staff expert for technical assistance related to applications, equipment and general product use.