Sequence: KVAAARCRNKKKERTEFLQRESERLELMNAELKTQIEELKQERQQLILMLNRHRPTCIVRTDSVKTPESEGNPLLEQLEKK
Jun dimerization protein 2; JUNDM2; progesterone receptor co-activator
Cat # 16111657
50 uL
Cat # 15741512
100 µL
Cat # 17191494
100 µL
Cat # 15664915
100 µL
Cat # 16107543
100 µg
Cat # 16684045
100 µL
Searching for an antibody we don't offer? We make custom antibodies for specific targets, species and applications.
More than 18,000 custom antibodies created so far.
Talk To A Specialist NowIf an Invitrogen™ antibody doesn’t perform as described on our website or datasheet, we’ll replace the product at no cost to you, or provide you with a credit for a future purchase.*
Get expert recommendations for common problems or connect directly with an on staff expert for technical assistance related to applications, equipment and general product use.