Sequence: MLSKVLPVFLGILLILQSRVEGPQTESKNEASSRDVVYGPQPQPLENQLLSEETKSTETETGSRVGKLPEASRILNTILSNYDHKLRPGIGEKPTVVTVE
GABA(A) receptor subunit epsilon; GABA(A) receptor, epsilon; gamma-aminobutyric acid (GABA) A receptor, epsilon; Gamma-aminobutyric acid receptor subunit epsilon
Cat # 16108454
200 uL
Cat # 16198444
50 µg
Cat # 13454747
100 µL
Cat # 16024827
100 uL
Cat # 15514572
100 µL
Cat # 15748941
100 µL
Cat # 16382204
100 µg
Searching for an antibody we don't offer? We make custom antibodies for specific targets, species and applications.
More than 18,000 custom antibodies created so far.
Talk To A Specialist NowIf an Invitrogen™ antibody doesn’t perform as described on our website or datasheet, we’ll replace the product at no cost to you, or provide you with a credit for a future purchase.*
Get expert recommendations for common problems or connect directly with an on staff expert for technical assistance related to applications, equipment and general product use.