Sequence: AVYIGALFPMSGGWPGGQACQPAVEMALEDVNSRRDILPDYELKLIHHDSKCDPGQATKYLYELLYNDPIKIILMPGCSSVSTLVAEAARMWNLIVLSYG
FLJ92613/GABAB(1e)/GABABR1/GABBR1-3/GPRC3A/dJ271M21.1.1/dJ271M21.1.2/hGB1a; GABA-B receptor 1; GABA-B receptor, R1 subunit; gamma-aminobutyric acid (GABA) B receptor, 1; Gamma-aminobutyric acid type B receptor subunit 1; seven transmembrane helix receptor
Cat # 16178424
100 ug
Cat # 16092617
100 ug
Cat # 16327204
100 µl
Cat # 16290300
100 µg
Cat # 16290290
100 µg
Cat # 12332463
100 µg
Cat # 15314601
50 µg
Cat # 16096397
50 ug
Cat # 11512392
100 µL
Cat # 16220300
100 µg
Cat # 16001307
100 ug
Cat # 16051257
100 uL
Cat # 15324601
50 µg
Cat # 16142230
100 ug
Cat # 16280300
100 µg
Cat # 11581541
100 µL
Cat # 11599010
0.1 mg
Cat # 16089946
100 ug
Cat # 16362214
100 µg
Cat # 16006407
50 ug
Cat # 13401887
100 µL
Cat # 16200300
100 µg
Searching for an antibody we don't offer? We make custom antibodies for specific targets, species and applications.
More than 18,000 custom antibodies created so far.
Talk To A Specialist NowIf an Invitrogen™ antibody doesn’t perform as described on our website or datasheet, we’ll replace the product at no cost to you, or provide you with a credit for a future purchase.*
Get expert recommendations for common problems or connect directly with an on staff expert for technical assistance related to applications, equipment and general product use.